Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05366
Gene name
Locationscaffold_05:3410404..3414241
Strand-
Gene length (bp)3837
Transcript length (bp)3759
Coding sequence length (bp)3759
Protein length (aa) 1253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.0E-50 1016 1243
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 3.1E-15 143 193
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-06 585 892
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.4E-04 667 777

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 1127 1149 22
2 1158 1180 22
3 1184 1206 22
4 1211 1233 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 57.01 30.83 83.20
Alive In ants, during behavior modification 56.12 30.38 81.86
Dead In ants, recently dead 41.33 23.08 59.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.950457 no
Alive Dead 0.065266 no
Dead Fungus 0.096503 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05366
MGGMPPSPPFRVPDSPTHDPDSDLDLDPDLDLGLDDLDPISPTHHRPPEQSAPRIALRNLRMGSLRRAQKRGRAY
GQLGTPRDDTADTDSGNDDAPLLGGDQWAQPPRRESRVRLPGFMTDNDGPRHHDASASRTVVVGGTQAMRFPANL
VSNAKYTALTFLPVTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLAFVLLITMGKEAYDDIERRRRDT
EANSEPYRVLTFDDAELTAASLRQRRPLKSDTMRRGSRRARRHDLSAIQEEDDDVDAVPSSHVQEVSRKSKDLKV
GQVLKLSKGQRVPADVVILQCCASDGCASREPAAEEALLASAEDGSASKGKQPALMHELEAGNVGETFIRTDQLD
GETDWKLRLATPLTQNLPVEEFVRLRVTGGKPDKSVNEFFGTLELLPPQRQVSSSQEAEQSDETAKSWALSIDNT
AWANTVIASQGTTLAVILYTGPETRSALSTAPSRSKTGLLEYEINSLTKILCALTLALSILLVALQGFEKTGGNA
WYIKMMRFLVLFSTIVPISLRVNLDLGKSAYSRFIQHDPGIPGAVVRTSTIPEDLGRIEYLLSDKTGTLTQNDME
MKKIHVGTVSYANEAMDEVAAYVKQGFVVDAYPMLVTPSSSVGNVGTSRTRRDIASRVRDVVLALALCHNVTPTV
DSEDGRQVTSYQASSPDEIAIVKWAESVGLRLASRDRKSMTLQSTESGRTVVRVRVLDVFPFTSDGKRMGIIVHF
QEKMDAPSTDLGSGDIWFYQKGADTVMSSIVASNDWLDEETANMAREGLRTLVVGRKKLSAQQYSEFSSRHHEAS
LSLSGRDMGMQTVVSRYLETDLELLGVTGVEDKLQRDVKPSLELLRNAGIKIWMLTGDKVETARCVAVSSKLVAR
GQYIQTMARLKKKDYARDQLDVLRSKMDACLLIDGESLALLLTHFRLDFISMAVQLPTVVACRCSPTQKAEVAKL
IKDYTKKRVCCIGDGGNDVSMIQAADVGVGIVGKEGRQASLAADFSIEQFCHLVKLLVWHGRNSYKRSAKLAQFV
IHRGLIIAVCQTMYSIALEFEPEGLYKDWLLVGYATVYTAAPVLSLVLDRDVDEDVANLYPELYKELTSGRSLSY
RTFFVWVLVSVYQGGMIQGLSQLLTQVNGPKMVAVSYTVLVLNELIMVAIEITTWHPVMIISILGTFLIFAGSIP
FLGGYFDLKFIVTLGFFWRIFAIGAISLVPPYAGKLIRRAIKPPSYRKVQSR*
Coding >Ophcf2|05366
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGTGCCCGATTCGCCAACGCATGATCCCGACTCGGATCTTGAC
CTAGATCCGGACCTTGATCTCGGCCTCGACGACCTCGATCCCATCTCGCCTACCCACCATCGCCCGCCCGAGCAG
TCGGCGCCACGGATAGCGCTCAGGAATCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGACACCGACAGCGGCAATGACGATGCGCCCTTGCTGGGCGGC
GACCAGTGGGCTCAGCCGCCCCGTCGTGAGTCTCGTGTACGCCTACCCGGCTTCATGACCGATAACGACGGGCCT
CGGCACCATGACGCCTCGGCTTCGAGGACCGTCGTCGTGGGCGGCACCCAGGCTATGCGCTTCCCTGCCAATCTC
GTCTCCAACGCCAAATACACCGCTCTTACATTTCTCCCCGTCACTTTATACAACGAATTCTCCTTTTTCTTCAAC
ATGTACTTCCTGCTCGTCGCTCTTTCCCAGGCCATCCCGGCTCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCCTTGGCCTTTGTTCTGCTGATCACCATGGGCAAAGAGGCCTACGATGACATTGAGCGGCGCAGGAGAGACACC
GAGGCCAACTCGGAGCCCTACCGGGTTCTCACATTTGACGATGCCGAATTGACCGCCGCCTCCCTCCGTCAGCGC
CGGCCTCTCAAGTCCGACACCATGAGACGAGGTTCGCGGAGGGCGAGAAGACACGATCTCTCCGCCATCCAGGAA
GAGGACGACGATGTCGACGCTGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAAGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGCGAGTACCGGCCGATGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCGCCTCCAGGGAGCCCGCGGCCGAGGAAGCCTTACTGGCATCTGCCGAGGACGGATCTGCCTCGAAGGGA
AAGCAGCCTGCGCTCATGCACGAGCTCGAGGCCGGCAATGTCGGGGAGACGTTCATCAGAACCGACCAGCTCGAT
GGCGAGACAGACTGGAAACTGAGGCTGGCGACCCCTCTGACGCAAAATCTTCCTGTCGAAGAGTTTGTCCGCCTT
CGAGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCTTCGGCACGCTGGAGCTGCTCCCGCCGCAGCGA
CAAGTCTCGTCGAGCCAGGAGGCGGAGCAGAGCGACGAAACCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCGCAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCAGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGTTCCAAGACGGGTCTTCTCGAGTATGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCCTAACACTGGCCCTGTCCATCTTGCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAATGCC
TGGTACATCAAGATGATGCGTTTCCTCGTCCTCTTCTCCACCATTGTACCCATCAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCGTACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTCGTCCGGACGAGCACC
ATTCCGGAGGATCTCGGACGGATCGAATACCTACTCAGCGACAAAACGGGCACATTGACACAGAACGATATGGAG
ATGAAGAAGATCCACGTCGGCACCGTCTCGTACGCTAACGAGGCCATGGACGAGGTGGCCGCCTATGTCAAGCAG
GGCTTCGTCGTCGACGCTTACCCGATGCTCGTCACGCCTTCGTCTTCCGTCGGTAACGTCGGCACGAGCCGGACA
AGACGAGACATTGCTTCCCGCGTACGAGACGTCGTCTTGGCCCTGGCGCTCTGTCACAACGTGACGCCGACTGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAGGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGGGACCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGACC
GTGGTTCGCGTCCGAGTTCTCGACGTCTTCCCGTTCACGTCGGACGGCAAGCGGATGGGTATCATCGTCCACTTT
CAGGAAAAGATGGACGCGCCCTCAACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCTGATACC
GTCATGAGCTCCATCGTGGCCTCCAACGACTGGCTAGACGAGGAGACGGCCAACATGGCGCGAGAGGGCTTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCCTCGCGCCATCACGAGGCCTCG
CTCTCCCTGTCCGGACGCGACATGGGCATGCAGACTGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAGAGGGACGTCAAGCCGTCGCTGGAGTTACTGCGCAACGCCGGCATC
AAGATTTGGATGCTTACAGGCGACAAGGTCGAGACGGCCAGGTGCGTGGCCGTCAGCTCCAAGCTTGTGGCTCGT
GGTCAGTACATTCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGCGACCAGCTCGACGTCCTCCGTAGC
AAGATGGACGCTTGTCTGCTAATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCATTTTCGACTCGACTTCATC
TCCATGGCCGTCCAGCTTCCGACGGTGGTGGCCTGTCGCTGCTCACCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGATTACACCAAGAAGCGCGTCTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGCATCGTCGGCAAGGAGGGCCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTTGTCAAGCTACTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCGCAGTTCGTC
ATTCATCGAGGTCTCATCATTGCCGTCTGCCAGACCATGTACAGCATCGCTCTCGAGTTTGAGCCCGAGGGCCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCCACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTTGACAGG
GACGTGGACGAGGATGTGGCCAACCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGCTGTCGTAT
CGCACCTTTTTCGTCTGGGTGCTGGTGTCAGTCTATCAAGGGGGCATGATTCAGGGCTTGTCGCAGCTCCTCACC
CAAGTCAACGGCCCCAAGATGGTGGCCGTCAGCTACACGGTCCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATAAGCATTCTCGGCACTTTTCTCATTTTCGCCGGTTCCATTCCC
TTCTTGGGGGGGTATTTCGACCTCAAGTTCATCGTTACATTGGGCTTCTTCTGGCGCATCTTCGCCATCGGTGCA
ATCTCGCTCGTGCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCTTCTTACAGAAAGGTCCAG
AGCAGGTAG
Transcript >Ophcf2|05366
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGTGCCCGATTCGCCAACGCATGATCCCGACTCGGATCTTGAC
CTAGATCCGGACCTTGATCTCGGCCTCGACGACCTCGATCCCATCTCGCCTACCCACCATCGCCCGCCCGAGCAG
TCGGCGCCACGGATAGCGCTCAGGAATCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGACACCGACAGCGGCAATGACGATGCGCCCTTGCTGGGCGGC
GACCAGTGGGCTCAGCCGCCCCGTCGTGAGTCTCGTGTACGCCTACCCGGCTTCATGACCGATAACGACGGGCCT
CGGCACCATGACGCCTCGGCTTCGAGGACCGTCGTCGTGGGCGGCACCCAGGCTATGCGCTTCCCTGCCAATCTC
GTCTCCAACGCCAAATACACCGCTCTTACATTTCTCCCCGTCACTTTATACAACGAATTCTCCTTTTTCTTCAAC
ATGTACTTCCTGCTCGTCGCTCTTTCCCAGGCCATCCCGGCTCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCCTTGGCCTTTGTTCTGCTGATCACCATGGGCAAAGAGGCCTACGATGACATTGAGCGGCGCAGGAGAGACACC
GAGGCCAACTCGGAGCCCTACCGGGTTCTCACATTTGACGATGCCGAATTGACCGCCGCCTCCCTCCGTCAGCGC
CGGCCTCTCAAGTCCGACACCATGAGACGAGGTTCGCGGAGGGCGAGAAGACACGATCTCTCCGCCATCCAGGAA
GAGGACGACGATGTCGACGCTGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAAGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGCGAGTACCGGCCGATGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCGCCTCCAGGGAGCCCGCGGCCGAGGAAGCCTTACTGGCATCTGCCGAGGACGGATCTGCCTCGAAGGGA
AAGCAGCCTGCGCTCATGCACGAGCTCGAGGCCGGCAATGTCGGGGAGACGTTCATCAGAACCGACCAGCTCGAT
GGCGAGACAGACTGGAAACTGAGGCTGGCGACCCCTCTGACGCAAAATCTTCCTGTCGAAGAGTTTGTCCGCCTT
CGAGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCTTCGGCACGCTGGAGCTGCTCCCGCCGCAGCGA
CAAGTCTCGTCGAGCCAGGAGGCGGAGCAGAGCGACGAAACCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCGCAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCAGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGTTCCAAGACGGGTCTTCTCGAGTATGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCCTAACACTGGCCCTGTCCATCTTGCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAATGCC
TGGTACATCAAGATGATGCGTTTCCTCGTCCTCTTCTCCACCATTGTACCCATCAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCGTACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTCGTCCGGACGAGCACC
ATTCCGGAGGATCTCGGACGGATCGAATACCTACTCAGCGACAAAACGGGCACATTGACACAGAACGATATGGAG
ATGAAGAAGATCCACGTCGGCACCGTCTCGTACGCTAACGAGGCCATGGACGAGGTGGCCGCCTATGTCAAGCAG
GGCTTCGTCGTCGACGCTTACCCGATGCTCGTCACGCCTTCGTCTTCCGTCGGTAACGTCGGCACGAGCCGGACA
AGACGAGACATTGCTTCCCGCGTACGAGACGTCGTCTTGGCCCTGGCGCTCTGTCACAACGTGACGCCGACTGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAGGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGGGACCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGACC
GTGGTTCGCGTCCGAGTTCTCGACGTCTTCCCGTTCACGTCGGACGGCAAGCGGATGGGTATCATCGTCCACTTT
CAGGAAAAGATGGACGCGCCCTCAACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCTGATACC
GTCATGAGCTCCATCGTGGCCTCCAACGACTGGCTAGACGAGGAGACGGCCAACATGGCGCGAGAGGGCTTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCCTCGCGCCATCACGAGGCCTCG
CTCTCCCTGTCCGGACGCGACATGGGCATGCAGACTGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAGAGGGACGTCAAGCCGTCGCTGGAGTTACTGCGCAACGCCGGCATC
AAGATTTGGATGCTTACAGGCGACAAGGTCGAGACGGCCAGGTGCGTGGCCGTCAGCTCCAAGCTTGTGGCTCGT
GGTCAGTACATTCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGCGACCAGCTCGACGTCCTCCGTAGC
AAGATGGACGCTTGTCTGCTAATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCATTTTCGACTCGACTTCATC
TCCATGGCCGTCCAGCTTCCGACGGTGGTGGCCTGTCGCTGCTCACCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGATTACACCAAGAAGCGCGTCTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGCATCGTCGGCAAGGAGGGCCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTTGTCAAGCTACTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCGCAGTTCGTC
ATTCATCGAGGTCTCATCATTGCCGTCTGCCAGACCATGTACAGCATCGCTCTCGAGTTTGAGCCCGAGGGCCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCCACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTTGACAGG
GACGTGGACGAGGATGTGGCCAACCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGCTGTCGTAT
CGCACCTTTTTCGTCTGGGTGCTGGTGTCAGTCTATCAAGGGGGCATGATTCAGGGCTTGTCGCAGCTCCTCACC
CAAGTCAACGGCCCCAAGATGGTGGCCGTCAGCTACACGGTCCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATAAGCATTCTCGGCACTTTTCTCATTTTCGCCGGTTCCATTCCC
TTCTTGGGGGGGTATTTCGACCTCAAGTTCATCGTTACATTGGGCTTCTTCTGGCGCATCTTCGCCATCGGTGCA
ATCTCGCTCGTGCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCTTCTTACAGAAAGGTCCAG
AGCAGGTAG
Gene >Ophcf2|05366
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGTGCCCGATTCGCCAACGCATGATCCCGACTCGGATCTTGAC
CTAGATCCGGACCTTGATCTCGGCCTCGACGACCTCGATCCCATCTCGCCTACCCACCATCGCCCGCCCGAGCAG
TCGGCGCCACGGATAGCGCTCAGGAATCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGACACCGACAGCGGCAATGACGATGCGCCCTTGCTGGGCGGC
GACCAGTGGGCTCAGCCGCCCCGTCGTGAGTCTCGTGTACGCCTACCCGGCTTCATGACCGATAACGACGGGCCT
CGGCACCATGACGCCTCGGCTTCGAGGACCGTCGTCGTGGGCGGCACCCAGGCTATGCGCTTCCCTGCCAATCTC
GTCTCCAACGCCAAATACACCGCTCTTACATTTCTCCCCGTCACTTTATACAACGAATTCTCCTTTTTCTTCAAC
ATGTACTTCCTGCTCGTCGCTCTTTCCCAGGCCATCCCGGCTCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCCTTGGCCTTTGTTCTGCTGATCACCATGGGCAAAGAGGCCTACGATGACATTGAGCGGCGCAGGAGAGACACC
GAGGCCAACTCGGAGCCCTACCGGGTTCTCACATTTGACGATGCCGAATTGACCGCCGCCTCCCTCCGTCAGCGC
CGGCCTCTCAAGTCCGACACCATGAGACGAGGTTCGCGGAGGGCGAGAAGACACGATCTCTCCGCCATCCAGGAA
GAGGACGACGATGTCGACGCTGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAAGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGCGAGTACCGGCCGATGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCGCCTCCAGGGAGCCCGCGGCCGAGGAAGCCTTACTGGCATCTGCCGAGGACGGATCTGCCTCGAAGGGA
AAGCAGCCTGCGCTCATGCACGAGCTCGAGGCCGGCAATGTCGGGGAGACGTTCATCAGAACCGACCAGCTCGAT
GGCGAGACAGACTGGAAACTGAGGCTGGCGACCCCTCTGACGCAAAATCTTCCTGTCGAAGAGTTTGTCCGCCTT
CGAGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCTTCGGCACGCTGGAGCTGCTCCCGCCGCAGCGA
CAAGTCTCGTCGAGCCAGGAGGCGGAGCAGAGCGACGAAACCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCGCAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCAGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGTTCCAAGACGGGTCTTCTCGAGTATGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCCTAACACTGGCCCTGTCCATCTTGCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAATGCC
TGGTACATCAAGATGATGCGTTTCCTCGTCCTCTTCTCCACCATTGTACCCATCAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCGTACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTCGTCCGGACGAGCACC
ATTCCGGAGGATCTCGGACGGATCGAATACCTACTCAGCGACAAAACGGGCACATTGACACAGAACGATATGGAG
ATGAAGAAGATCCACGTCGGCACCGTCTCGTACGCTAACGAGGCCATGGACGAGGTGGCCGCCTATGTCAAGCAG
GGCTTCGTCGTCGACGCTTACCCGATGCTCGTCACGCCTTCGTCTTCCGTCGGTAACGTCGGCACGAGCCGGACA
AGACGAGACATTGCTTCCCGCGTACGAGACGTCGTCTTGGCCCTGGCGCTCTGTCACAACGTGACGCCGACTGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAGGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGGGACCGCAAGAGCATGACGCTGCAGTCGACGGAGAGCGGCCGGACC
GTGGTTCGCGTCCGAGTTCTCGACGTCTTCCCGTTCACGTCGGACGGCAAGCGGATGGGTATCATCGTCCACTTT
CAGGAAAAGATGGACGCGCCCTCAACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCTGATACC
GTCATGAGCTCCATCGTGGCCTCCAACGACTGGCTAGACGAGGAGACGGCCAACATGGCGCGAGAGGGCTTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCCTCGCGCCATCACGAGGCCTCG
CTCTCCCTGTCCGGACGCGACATGGGCATGCAGACTGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAGAGGGACGTCAAGCCGTCGCTGGAGTTACTGCGCAACGCCGGCATC
AAGATTTGGATGCTTACAGGCGACAAGGTCGAGACGGCCAGGTGCGTGGCCGTCAGCTCCAAGCTTGTGGCTCGT
GGTCAGTACATTCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGCGACCAGCTCGACGTCCTCCGTAGC
AAGATGGACGCTTGTCTGCTAATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCATTTTCGACTCGACTTCATC
TCCATGGCCGTCCAGCTTCCGACGGTGGTGGCCTGTCGCTGCTCACCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGATTACACCAAGAAGCGCGTCTGCTGCATAGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGCATCGTCGGCAAGGAGGGCCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTTGTCAAGCTACTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCGCAGTTCGTC
ATTCATCGAGGTCTCATCATTGCCGTCTGCCAGACCATGTACAGCATCGCTCTCGAGTTTGAGCCCGAGGGCCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCCACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTTGACAGG
GACGTGGACGAGGATGTGGCCAACCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGCTGTCGTAT
CGCACCTTTTTCGTCTGGGTGCTGGTGTCAGTCTATCAAGGGGGCATGATTCAGGGCTTGTCGCAGCTCCTCACC
CAAGTCAACGGCCCCAAGATGGTGGCCGTCAGCTACACGGTCCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATAAGCATTCTCGGCACTTTTCTCATTTTCGCCGGTTCCATTCCC
TTCTTGGGGGGGTATTTCGACCTCAAGTTCATCGTTACATTGTTCGTCCCTTGTTTCCCTACTTCTATCCGCACT
GGCCAGGGCCGTTGACTGACCTTGATCTCCTTCCCGTTCTATAGGGGCTTCTTCTGGCGCATCTTCGCCATCGGT
GCAATCTCGCTCGTGCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCTTCTTACAGAAAGGTC
CAGAGCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail