Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05365
Gene name
Locationscaffold_05:3408919..3410077
Strand+
Gene length (bp)1158
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 5.1E-08 67 155
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 4.4E-05 172 213

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.152 0.1313 0.1975 0.0776 0.87 0.2104 0.1993 0.1218 0.1721 0.0501

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1350
Ophiocordyceps australis map64 (Brazil) OphauB2|6025
Ophiocordyceps camponoti-floridani Ophcf2|05365 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4315
Ophiocordyceps kimflemingae Ophio5|8262

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05365
MGPVPGQKIRPLPRAVSSRPPRSSRAAGAATVVLAAAAAAASTTAYYHYNDDDDATTTLNRDSFTRCVVTRKDPV
SPSSSILTVSAPPTSLRGLWSVEFKQPEVQIARHYTPLPPYDDDDGRLLRFYIRSLPRGEMSSYLDRLRPGHHLW
LRGPHPGFDVLRRLGSCKRLVFLAGGTGLAPAMQAASTVLEHDDDPNTSATLLWAVRQHQEIQASAYTPPPWWKL
WLRRPSPIDLDAHVEDATPIALQLRRMKNKYGPRLNIRIAIHSDGSAFQTHDIEQALLRPSSSDRSTPTSNSRGC
QCHNQSLHASASEFQPPNDACQCQSTADAGKNILIVSGSDGFVSHYAGPKVWARGLLTQGPVGGLVADLQRRHPS
LARDWLVLKL*
Coding >Ophcf2|05365
ATGGGCCCAGTCCCCGGACAGAAGATCCGACCCCTCCCTCGCGCGGTATCGAGCCGCCCACCGCGTTCCTCCCGC
GCCGCAGGTGCCGCGACCGTCGTGCTGGCAGCAGCAGCAGCAGCAGCATCAACAACAGCATACTACCACTACAAC
GACGACGACGACGCGACGACGACGCTGAACCGAGATAGCTTCACTCGTTGCGTCGTCACCCGAAAAGATCCTGTT
TCGCCCTCGTCCTCCATCCTCACCGTCAGCGCGCCACCAACTTCGCTCCGCGGCTTGTGGTCTGTCGAGTTCAAG
CAGCCCGAGGTGCAGATCGCCCGTCACTACACGCCTCTGCCTCCCTACGATGACGACGACGGCCGCCTTTTGCGC
TTCTATATTCGCTCCCTCCCGAGAGGCGAGATGTCGTCGTACCTCGATCGTCTCCGTCCAGGACACCATCTCTGG
CTACGAGGCCCGCATCCGGGCTTCGATGTCCTCCGTCGCCTCGGCTCCTGCAAGCGACTCGTCTTCCTAGCTGGA
GGCACCGGCCTTGCCCCAGCCATGCAGGCTGCTTCCACCGTTCTCGAACACGATGACGATCCCAACACCTCGGCC
ACCCTCCTCTGGGCCGTGCGGCAACATCAGGAGATCCAGGCCTCGGCATACACCCCTCCTCCCTGGTGGAAGCTG
TGGCTACGGAGACCGTCGCCAATCGATCTAGACGCTCATGTAGAGGACGCGACGCCCATTGCGCTACAGCTGCGG
CGAATGAAGAACAAATATGGGCCCCGGCTGAACATCCGCATCGCCATCCACAGCGACGGCTCCGCATTCCAAACC
CACGACATCGAGCAAGCCCTCCTCCGTCCATCATCATCCGATCGATCCACCCCCACATCGAACAGTCGAGGCTGT
CAATGCCACAACCAGAGCCTCCACGCCTCCGCCTCAGAGTTTCAACCCCCCAACGACGCCTGCCAATGTCAGTCC
ACTGCCGACGCAGGCAAAAACATCCTCATCGTCTCCGGGTCCGACGGCTTCGTCTCCCACTACGCAGGTCCCAAG
GTCTGGGCCCGAGGCCTTCTGACGCAAGGGCCCGTTGGTGGTCTCGTCGCCGACCTGCAGAGACGACATCCGAGC
CTGGCCCGCGATTGGCTCGTGCTGAAGCTCTGA
Transcript >Ophcf2|05365
ATGGGCCCAGTCCCCGGACAGAAGATCCGACCCCTCCCTCGCGCGGTATCGAGCCGCCCACCGCGTTCCTCCCGC
GCCGCAGGTGCCGCGACCGTCGTGCTGGCAGCAGCAGCAGCAGCAGCATCAACAACAGCATACTACCACTACAAC
GACGACGACGACGCGACGACGACGCTGAACCGAGATAGCTTCACTCGTTGCGTCGTCACCCGAAAAGATCCTGTT
TCGCCCTCGTCCTCCATCCTCACCGTCAGCGCGCCACCAACTTCGCTCCGCGGCTTGTGGTCTGTCGAGTTCAAG
CAGCCCGAGGTGCAGATCGCCCGTCACTACACGCCTCTGCCTCCCTACGATGACGACGACGGCCGCCTTTTGCGC
TTCTATATTCGCTCCCTCCCGAGAGGCGAGATGTCGTCGTACCTCGATCGTCTCCGTCCAGGACACCATCTCTGG
CTACGAGGCCCGCATCCGGGCTTCGATGTCCTCCGTCGCCTCGGCTCCTGCAAGCGACTCGTCTTCCTAGCTGGA
GGCACCGGCCTTGCCCCAGCCATGCAGGCTGCTTCCACCGTTCTCGAACACGATGACGATCCCAACACCTCGGCC
ACCCTCCTCTGGGCCGTGCGGCAACATCAGGAGATCCAGGCCTCGGCATACACCCCTCCTCCCTGGTGGAAGCTG
TGGCTACGGAGACCGTCGCCAATCGATCTAGACGCTCATGTAGAGGACGCGACGCCCATTGCGCTACAGCTGCGG
CGAATGAAGAACAAATATGGGCCCCGGCTGAACATCCGCATCGCCATCCACAGCGACGGCTCCGCATTCCAAACC
CACGACATCGAGCAAGCCCTCCTCCGTCCATCATCATCCGATCGATCCACCCCCACATCGAACAGTCGAGGCTGT
CAATGCCACAACCAGAGCCTCCACGCCTCCGCCTCAGAGTTTCAACCCCCCAACGACGCCTGCCAATGTCAGTCC
ACTGCCGACGCAGGCAAAAACATCCTCATCGTCTCCGGGTCCGACGGCTTCGTCTCCCACTACGCAGGTCCCAAG
GTCTGGGCCCGAGGCCTTCTGACGCAAGGGCCCGTTGGTGGTCTCGTCGCCGACCTGCAGAGACGACATCCGAGC
CTGGCCCGCGATTGGCTCGTGCTGAAGCTCTGA
Gene >Ophcf2|05365
ATGGGCCCAGTCCCCGGACAGAAGATCCGACCCCTCCCTCGCGCGGTATCGAGCCGCCCACCGCGTTCCTCCCGC
GCCGCAGGTGCCGCGACCGTCGTGCTGGCAGCAGCAGCAGCAGCAGCATCAACAACAGCATACTACCACTACAAC
GACGACGACGACGCGACGACGACGCTGAACCGAGATAGCTTCACTCGTTGCGTCGTCACCCGAAAAGATCCTGTT
TCGCCCTCGTCCTCCATCCTCACCGTCAGCGCGCCACCAACTTCGCTCCGCGGCTTGTGGTCTGTCGAGTTCAAG
CAGCCCGAGGTGCAGATCGCCCGTCACTACACGCCTCTGCCTCCCTACGATGACGACGACGGCCGCCTTTTGCGC
TTCTATATTCGCTCCCTCCCGAGAGGCGAGATGTCGTCGTACCTCGATCGTCTCCGTCCAGGACACCATCTCTGG
CTACGAGGCCCGCATCCGGGCTTCGATGTCCTCCGTCGCCTCGGCTCCTGCAAGCGACTCGTCTTCCTAGCTGGA
GGCACCGGCCTTGCCCCAGCCATGCAGGCTGCTTCCACCGTTCTCGAACACGATGACGATCCCAACACCTCGGCC
ACCCTCCTCTGGGCCGTGCGGCAACATCAGGAGATCCAGGCCTCGGCATACACCCCTCCTCCCTGGTGGAAGCTG
TGGCTACGGAGACCGTCGCCAATCGATCTAGACGCTCATGTAGAGGACGCGACGCCCATTGCGCTACAGCTGCGG
CGAATGAAGAACAAATATGGGCCCCGGCTGAACATCCGCATCGCCATCCACAGCGACGGCTCCGCATTCCAAACC
CACGACATCGAGCAAGCCCTCCTCCGTCCATCATCATCCGATCGATCCACCCCCACATCGAACAGTCGAGGCTGT
CAATGCCACAACCAGAGCCTCCACGCCTCCGCCTCAGAGTTTCAACCCCCCAACGACGCCTGCCAATGTCAGTCC
ACTGCCGACGCAGGCAAAAACATCCTCATCGTCTCCGGGTCCGACGGCTTCGTCTCCCACTACGCAGGTCCCAAG
GTCTGGGCCCGAGGCCTTCTGACGCAAGGGCCCGTTGGTGGTCTCGTCGCCGACCTGCAGAGACGACATCCGAGC
CTGGCCCGCGATTGGCTCGTGCTGAAGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail