Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05358
Gene name
Locationscaffold_05:3393538..3394160
Strand+
Gene length (bp)622
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08648 SNRNP27 U4/U6.U5 small nuclear ribonucleoproteins 1.9E-29 126 181

GO

GO Term Description Terminal node
GO:0008380 RNA splicing Yes
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4835 0.8008 0.0598 0.0968 0.065 0.0014 0.0241 0.0376 0.0074 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6139
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7809
Ophiocordyceps australis map64 (Brazil) OphauB2|8013
Ophiocordyceps camponoti-floridani Ophcf2|05358 (this protein)
Ophiocordyceps kimflemingae Ophio5|8251
Ophiocordyceps subramaniannii Hirsu2|4548

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05358
MNDPRRSRRQNNYREGSRYESHYDNRQENRYENRHDNRHDNRHDNRHDNRHDNRYESRYDNRNEARHPSRYSPPG
TNPPTAAHAPAPAPPEEPKTSRTRAETEPKLKMEDFVKKEDIMVDQEAGSDDEAAMKQMMGFAGFGSTKGKKIPG
NDAGAVRKEKKTEYRQYMNRHGGFNRPLSPTR*
Coding >Ophcf2|05358
ATGAACGACCCTCGCCGCTCCCGCCGCCAGAACAACTATCGTGAAGGATCTCGCTACGAATCCCACTACGACAAT
CGCCAAGAGAACCGCTACGAGAATCGCCACGACAACCGCCACGACAACCGCCACGACAACCGCCACGACAACCGT
CACGACAACCGCTACGAATCCCGCTACGACAACCGCAACGAAGCCCGCCACCCATCCCGCTACTCCCCCCCCGGC
ACCAACCCTCCCACCGCCGCCCACGCTCCCGCTCCCGCTCCCCCCGAAGAACCCAAGACGTCGAGGACGAGAGCC
GAGACGGAGCCCAAGTTGAAGATGGAGGATTTCGTCAAGAAGGAGGATATAATGGTCGACCAAGAGGCCGGTAGC
GACGACGAGGCCGCGATGAAGCAAATGATGGGCTTTGCTGGCTTCGGCTCGACAAAGGGAAAGAAGATTCCGGGC
AACGACGCGGGAGCCGTTCGCAAGGAGAAGAAGACGGAGTATCGACAGTACATGAACCGTCATGGCGGATTCAAC
CGACCCCTGAGCCCGACTCGATGA
Transcript >Ophcf2|05358
ATGAACGACCCTCGCCGCTCCCGCCGCCAGAACAACTATCGTGAAGGATCTCGCTACGAATCCCACTACGACAAT
CGCCAAGAGAACCGCTACGAGAATCGCCACGACAACCGCCACGACAACCGCCACGACAACCGCCACGACAACCGT
CACGACAACCGCTACGAATCCCGCTACGACAACCGCAACGAAGCCCGCCACCCATCCCGCTACTCCCCCCCCGGC
ACCAACCCTCCCACCGCCGCCCACGCTCCCGCTCCCGCTCCCCCCGAAGAACCCAAGACGTCGAGGACGAGAGCC
GAGACGGAGCCCAAGTTGAAGATGGAGGATTTCGTCAAGAAGGAGGATATAATGGTCGACCAAGAGGCCGGTAGC
GACGACGAGGCCGCGATGAAGCAAATGATGGGCTTTGCTGGCTTCGGCTCGACAAAGGGAAAGAAGATTCCGGGC
AACGACGCGGGAGCCGTTCGCAAGGAGAAGAAGACGGAGTATCGACAGTACATGAACCGTCATGGCGGATTCAAC
CGACCCCTGAGCCCGACTCGATGA
Gene >Ophcf2|05358
ATGAACGACCCTCGCCGCTCCCGCCGCCAGAACAACTATCGTGAAGGATCTCGCTACGAATCCCACTACGACAAT
CGCCAAGAGAACCGCTACGAGAATCGCCACGACAACCGCCACGACAACCGCCACGACAACCGCCACGACAACCGT
CACGACAACCGCTACGAATCCCGCTACGACAACCGCAACGAAGCCCGCCACCCATCCCGCTACTCCCCCCCCGGC
ACCAACCCTCCCACCGCCGCCCACGCTCCCGCTCCCGCTCCCCCCGAAGAAGTCAACGCTCCCGCTCCCCCTCTC
CCGCCGTCCGCGCTCCCCCTTGCCAACCCGCATGAAACCCGATCCGGAGCCCAAGACGTCGAGGACGAGAGCCGA
GACGGAGCCCAAGTTGAAGATGGAGGATTTCGTCAAGAAGGAGGATATAATGGTCGACCAAGAGGCCGGTAGCGA
CGACGAGGCCGCGATGAAGCAAATGATGGGCTTTGCTGGCTTCGGCTCGACAAAGGGAAAGAAGATTCCGGGCAA
CGACGCGGGAGCCGTTCGCAAGGAGAAGAAGACGGAGTATCGACAGTACATGAACCGTCATGGCGGATTCAACCG
ACCCCTGAGCCCGACTCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail