Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05357
Gene name
Locationscaffold_05:3390514..3393262
Strand-
Gene length (bp)2748
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 2.2E-110 307 694
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 3.2E-12 706 761
PF16923 Glyco_hydro_63N Glycosyl hydrolase family 63 N-terminal domain 4.5E-76 37 268

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1351 0.0389 0.8092 0.0657 0.2738 0.09 0.591 0.4253 0.3416 0.0037

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999667

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7808
Ophiocordyceps australis map64 (Brazil) OphauB2|8014
Ophiocordyceps camponoti-floridani Ophcf2|05357 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|684
Ophiocordyceps kimflemingae Ophio5|8250
Ophiocordyceps subramaniannii Hirsu2|4206

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05357
MARLAGLAIVAAAASLVSGSGDESVLAAEINRLNNQSLFWGPYKPNLYFGVRPRVPQSLWTGLMWGRMEDFEDIK
DGFRYTCEQGKDIPGYGWDEFDARTGGVQTIHDEGNNIDISTSFVKIAGGGHGGSWAARIKGTPRASASAPEKLK
TTVVYYLAQEGDGEVEPEQQEGSEGGFKRDVLFRGRSDALGSYKMVITNGEGEHPTGDDDLSSTRPGDTTVVNSQ
QLPDDMLWQAKAVVFQQLQRAAAEVQESMADESKARPSPWQVYRVPHSPAKGNVHVVQKTFEGPFTFDVLFSSGS
SGVEVTSELATREMARASAAFSERFQRVFPLQEPFTGEEYVRFGKNMLSNLVGGMGYFYGDQLVDRSYAAEYDEE
GESFWIETAEARARGKQKLEGPYELFTAIPSRSFFPRGFLWDEGFHLLLISDWDLDLGLEVLSSWFATMDEDGWI
AREQILGAEARSKVPEEFRVQYPHYGNPPTLFLVVDGMLDRLRARSNGTSGTSRRLDTDKDDGERLYTAHLDNEE
LGWDYLRRLYPLLRRQYDWFRKTQRGEVKSYDRTAYAPKEAYRWRGRTETHCLTSGLDDYPRPQPPHPGELHVDL
LSWIGLMTGTLLRLSEGLGLTDEADELRTRLHGLQRNAVDLHWSESEGMFCDASVDDFEEHRLVCHSGYVSLMPL
LTGLVDAGDERTGRILEGLGEEGGSLEPVRVWMPVNWMVVVWLRGIATGTGPFRTRARTLHNELRRNLIRTVYES
WRETGFVWEQYGV*
Coding >Ophcf2|05357
ATGGCTCGACTTGCCGGACTCGCAATTGTGGCCGCGGCCGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAATCTGTACTTTGGG
GTGCGGCCACGGGTGCCGCAGTCGTTATGGACGGGATTGATGTGGGGGCGGATGGAGGATTTCGAGGATATCAAG
GATGGTTTTCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACG
GGAGGCGTGCAGACGATTCACGACGAGGGGAATAACATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGCGGT
GGTCATGGCGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGAGTGCGCCGGAGAAGCTCAAG
ACTACCGTCGTCTACTATCTCGCCCAGGAGGGAGACGGAGAAGTCGAGCCGGAGCAGCAGGAGGGTTCTGAAGGG
GGTTTCAAGCGCGACGTCTTGTTTCGCGGACGGTCCGATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGC
GAGGGAGAGCATCCGACCGGCGATGACGACCTCTCGTCGACGAGACCGGGCGACACGACGGTCGTCAACAGCCAG
CAACTCCCGGACGACATGCTCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCAGCCGAGGTA
CAGGAGTCCATGGCGGACGAGAGCAAAGCCAGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGTCCGGCC
AAGGGCAACGTGCACGTGGTGCAGAAGACGTTCGAGGGGCCCTTTACGTTTGACGTCTTGTTCTCGTCTGGCTCG
TCGGGGGTCGAGGTGACGTCCGAGTTGGCGACGAGGGAGATGGCGAGGGCGTCGGCCGCGTTTTCCGAACGTTTC
CAGCGCGTGTTCCCGCTGCAGGAGCCGTTCACGGGGGAGGAATACGTCAGGTTCGGGAAGAATATGCTGTCGAAC
CTCGTCGGGGGCATGGGATACTTTTACGGCGATCAGCTGGTTGACCGATCCTATGCGGCCGAGTACGACGAGGAG
GGCGAGTCGTTTTGGATCGAGACGGCAGAGGCGCGGGCTCGGGGGAAGCAGAAGCTCGAAGGGCCATATGAGCTG
TTCACGGCCATTCCTTCACGGTCCTTCTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATA
TCAGACTGGGACTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATC
GCTCGGGAGCAGATTCTGGGAGCCGAGGCCCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCATTAC
GGGAACCCCCCGACGCTGTTCCTCGTGGTGGACGGGATGCTGGACCGGTTACGGGCCCGGAGCAACGGGACGAGC
GGGACGAGCAGGCGGCTGGACACGGACAAGGACGACGGCGAGAGGCTCTATACGGCCCACCTGGACAACGAGGAG
CTCGGATGGGACTACCTGCGACGGCTCTATCCGCTGCTCCGAAGACAGTACGACTGGTTCCGCAAGACGCAGAGG
GGAGAGGTCAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGTACGGAGACG
CACTGCCTGACGAGCGGACTGGACGATTACCCGCGACCGCAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTT
CTGTCGTGGATCGGGCTGATGACTGGGACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGACCGACGAGGCAGAC
GAGCTCCGGACGCGGCTCCACGGGCTCCAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCCGAGGGCATGTTC
TGCGACGCTTCGGTGGACGACTTTGAGGAGCACCGGCTCGTCTGTCATTCGGGGTACGTCTCGCTGATGCCGCTG
CTTACGGGGCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGTCTCGGGGAGGAAGGGGGGTCT
CTGGAGCCGGTTCGGGTTTGGATGCCGGTGAATTGGATGGTGGTTGTGTGGTTGCGGGGCATCGCCACCGGGACA
GGCCCCTTCCGGACGCGAGCCCGGACGCTGCACAACGAGCTGCGAAGGAACCTGATCAGGACCGTCTACGAGAGC
TGGCGGGAGACGGGCTTCGTGTGGGAGCAGTATGGTGTCTGA
Transcript >Ophcf2|05357
ATGGCTCGACTTGCCGGACTCGCAATTGTGGCCGCGGCCGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAATCTGTACTTTGGG
GTGCGGCCACGGGTGCCGCAGTCGTTATGGACGGGATTGATGTGGGGGCGGATGGAGGATTTCGAGGATATCAAG
GATGGTTTTCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACG
GGAGGCGTGCAGACGATTCACGACGAGGGGAATAACATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGCGGT
GGTCATGGCGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGAGTGCGCCGGAGAAGCTCAAG
ACTACCGTCGTCTACTATCTCGCCCAGGAGGGAGACGGAGAAGTCGAGCCGGAGCAGCAGGAGGGTTCTGAAGGG
GGTTTCAAGCGCGACGTCTTGTTTCGCGGACGGTCCGATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGC
GAGGGAGAGCATCCGACCGGCGATGACGACCTCTCGTCGACGAGACCGGGCGACACGACGGTCGTCAACAGCCAG
CAACTCCCGGACGACATGCTCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCAGCCGAGGTA
CAGGAGTCCATGGCGGACGAGAGCAAAGCCAGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGTCCGGCC
AAGGGCAACGTGCACGTGGTGCAGAAGACGTTCGAGGGGCCCTTTACGTTTGACGTCTTGTTCTCGTCTGGCTCG
TCGGGGGTCGAGGTGACGTCCGAGTTGGCGACGAGGGAGATGGCGAGGGCGTCGGCCGCGTTTTCCGAACGTTTC
CAGCGCGTGTTCCCGCTGCAGGAGCCGTTCACGGGGGAGGAATACGTCAGGTTCGGGAAGAATATGCTGTCGAAC
CTCGTCGGGGGCATGGGATACTTTTACGGCGATCAGCTGGTTGACCGATCCTATGCGGCCGAGTACGACGAGGAG
GGCGAGTCGTTTTGGATCGAGACGGCAGAGGCGCGGGCTCGGGGGAAGCAGAAGCTCGAAGGGCCATATGAGCTG
TTCACGGCCATTCCTTCACGGTCCTTCTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATA
TCAGACTGGGACTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATC
GCTCGGGAGCAGATTCTGGGAGCCGAGGCCCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCATTAC
GGGAACCCCCCGACGCTGTTCCTCGTGGTGGACGGGATGCTGGACCGGTTACGGGCCCGGAGCAACGGGACGAGC
GGGACGAGCAGGCGGCTGGACACGGACAAGGACGACGGCGAGAGGCTCTATACGGCCCACCTGGACAACGAGGAG
CTCGGATGGGACTACCTGCGACGGCTCTATCCGCTGCTCCGAAGACAGTACGACTGGTTCCGCAAGACGCAGAGG
GGAGAGGTCAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGTACGGAGACG
CACTGCCTGACGAGCGGACTGGACGATTACCCGCGACCGCAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTT
CTGTCGTGGATCGGGCTGATGACTGGGACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGACCGACGAGGCAGAC
GAGCTCCGGACGCGGCTCCACGGGCTCCAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCCGAGGGCATGTTC
TGCGACGCTTCGGTGGACGACTTTGAGGAGCACCGGCTCGTCTGTCATTCGGGGTACGTCTCGCTGATGCCGCTG
CTTACGGGGCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGTCTCGGGGAGGAAGGGGGGTCT
CTGGAGCCGGTTCGGGTTTGGATGCCGGTGAATTGGATGGTGGTTGTGTGGTTGCGGGGCATCGCCACCGGGACA
GGCCCCTTCCGGACGCGAGCCCGGACGCTGCACAACGAGCTGCGAAGGAACCTGATCAGGACCGTCTACGAGAGC
TGGCGGGAGACGGGCTTCGTGTGGGAGCAGTATGGTGTCTGA
Gene >Ophcf2|05357
ATGGCTCGACTTGCCGGACTCGCAATTGTGGCCGCGGCCGCCTCGCTCGTCTCCGGCTCGGGCGACGAGTCGGTC
CTCGCTGCGGAGATCAACCGGCTCAACAACCAGAGCCTCTTCTGGGGACCGTACAAGCCGAATCTGTACTTTGGG
GTGCGGCCACGGGTGCCGCAGTCGTTATGGACGGGATTGATGTGGGGGCGGATGGAGGATTTCGAGGATATCAAG
GATGGTGGGTCTGGGGCAAAGGATTTCGTTGGGTCGATGCTGATGGGTGATGGGTGATGGGTGATGGGCAGGTTT
TCGGTATACGTGCGAGCAGGGGAAGGATATTCCCGGTTACGGATGGGATGAGTTTGATGCTCGGACGGGAGGCGT
GCAGACGATTCACGACGAGGGGAATAACATCGACATTTCGACTTCGTTTGTCAAGATTGCTGGCGGTGGTCATGG
CGGTAGCTGGGCGGCGAGGATCAAGGGGACGCCGAGGGCGAGTGCGAGTGCGCCGGAGAAGCTCAAGACTACCGT
CGTCTACTATCTCGCCCAGGAGGGAGACGGAGAAGTCGAGCCGGAGCAGCAGGAGGGTTCTGAAGGGGGTTTCAA
GCGCGACGTCTTGTTTCGCGGACGGTCCGATGCCCTCGGTTCCTACAAGATGGTCATCACGAACGGCGAGGGAGA
GCATCCGACCGGCGATGACGACCTCTCGTCGACGAGACCGGGCGACACGACGGTCGTCAACAGCCAGCAACTCCC
GGACGACATGCTCTGGCAGGCCAAGGCCGTCGTCTTCCAGCAGCTGCAGCGGGCGGCAGCCGAGGTACAGGAGTC
CATGGCGGACGAGAGCAAAGCCAGGCCGTCACCGTGGCAGGTATATCGCGTACCGCACAGTCCGGCCAAGGGCAA
CGTGCACGTGGTGCAGAAGACGTTCGAGGGGCCCTTTACGTTTGACGTCTTGTTCTCGTCTGGCTCGTCGGGGGT
CGAGGTGACGTCCGAGTTGGCGACGAGGGAGATGGCGAGGGCGTCGGCCGCGTTTTCCGAACGTTTCCAGCGCGT
GTTCCCGCTGCAGGAGCCGTTCACGGGGGAGGAATACGTCAGGTTCGGGAAGAATATGCTGTCGAACCTCGTCGG
GGGCATGGGATACTTTTACGGCGATCAGCTGGTTGACCGATCCTATGCGGCCGAGTACGACGAGGAGGGCGAGTC
GTTTTGGATCGAGACGGCAGAGGCGCGGGCTCGGGGGAAGCAGAAGCTCGAAGGGCCATATGAGCTGTTCACGGC
CATTCCTTCACGGTCCTTCTTCCCGCGCGGATTCCTGTGGGACGAGGGCTTCCACCTGTTGCTGATATCAGACTG
GGACTTGGACCTCGGGCTCGAGGTGCTGAGCAGCTGGTTCGCCACCATGGACGAGGACGGGTGGATCGCTCGGGA
GCAGATTCTGGGAGCCGAGGCCCGGAGCAAGGTGCCGGAGGAGTTCCGGGTGCAGTATCCGCATTACGGGAACCC
CCCGACGCTGTTCCTCGTGGTGGACGGGATGCTGGACCGGTTACGGGCCCGGAGCAACGGGACGAGCGGGACGAG
CAGGCGGCTGGACACGGACAAGGACGACGGCGAGAGGCTCTATACGGCCCACCTGGACAACGAGGAGCTCGGATG
GGACTACCTGCGACGGCTCTATCCGCTGCTCCGAAGACAGTACGACTGGTTCCGCAAGACGCAGAGGGGAGAGGT
CAAGTCGTACGACCGCACGGCGTACGCGCCCAAGGAAGCCTACCGGTGGCGAGGCCGTACGGAGACGCACTGCCT
GACGAGCGGACTGGACGATTACCCGCGACCGCAGCCTCCGCATCCGGGCGAGCTGCACGTGGACCTTCTGTCGTG
GATCGGGCTGATGACTGGGACGCTGCTGAGGCTATCCGAAGGGCTCGGCCTGACCGACGAGGCAGACGAGCTCCG
GACGCGGCTCCACGGGCTCCAGCGTAACGCCGTGGACCTGCATTGGTCCGAGTCCGAGGGCATGTTCTGCGACGC
TTCGGTGGACGACTTTGAGGAGCACCGGCTCGTCTGTCATTCGGGGTACGTCTCGCTGATGCCGCTGCTTACGGG
GCTGGTGGATGCCGGGGATGAGCGGACGGGGAGGATTCTGGAGGGTCTCGGGGAGGAAGGGGGGTCTCTGGAGCC
GGTTCGGGGTGAGGAGCTTGAGTCGTTCGGATGGGCTCTATGGGAGTGGAGAGGATTATTGGAGGGGGGCAGTTT
GGATGCCGGTGAATTGGATGGTGGTTGTGTGGTTGCGGGTGAGTCTTTCTTTTTCTTCTTCATTTTCCTTTATTT
TCCTTTTCTTTTATCGTCCCTTTTTTCTTTGCATATTTTGTTTTTATTTTGTTGATTCGTTGTTTTGTTTTGCTT
GGATGTTATTTCCGTCCTGTTTCGCCCGTCATTTCTTGCTGCCTGTTTTCCTTTTCCCCGAAGACGGTCGTGTTG
GCGATCCGATGACTCCCCATCTCGGCTACGCTAACCGAAACGTGCAGGGCATCGCCACCGGGACAGGCCCCTTCC
GGACGCGAGCCCGGACGCTGCACAACGAGCTGCGAAGGAACCTGATCAGGACCGTCTACGAGAGCTGGCGGGAGA
CGGGCTTCGTGTGGGAGCAGTATGGTGGTGAGGATGGGGGGGGAGGAGGACGGGGGGTTCACGGGATGGACCAGC
CTTGTGCTTTCTCTGATGGCTCTGGGGGATGTCTAGAGGATAGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail