Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05344
Gene name
Locationscaffold_05:3364330..3366513
Strand-
Gene length (bp)2183
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.4E-112 33 500
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-16 36 440

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 79 98 19
3 105 124 19
4 134 156 22
5 163 185 22
6 198 220 22
7 294 316 22
8 331 353 22
9 360 382 22
10 392 414 22
11 434 453 19
12 463 485 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05344
MALVKLLRLAVRNEAMRSDPVEIYGWRVFALVCAACFGGMLFGWETGAIGGILAMKPAQDRFGTLGASKADRSNL
DQNIVSTLQAGCFAACLVTSWLTDRFGRKSCLVATGGLALVGVVMQAASAISGSLPVMYVGRFVAGLGVGAASTL
TPLYVSECAPRAIRGGLTAFYQLFIVCGIMLAFWVNYGCVLHVPSPAVFILPLSLQALPAVLLIVGMALSPESPR
WCARQDDWERTTKILVRLRGLPADSDYVSGEIREIADQLEAERRLMGDATALSLLKEMVLIPGNRNRAIISVVLM
ICQQMTGVNAINYYAPQIFQNLGMDGTNTSLFATGVYGVAKTAACAAFLVFVADSLGRRWSLLWTSAAQAFVLFV
IGIYGRVQPPVPGQPVSAFGYVAIACIYLWAAAFQFGWGPACWILVSEIPTARLRAMNVALAAAVQWLFNFVMAR
TVLTMQNTMGRAGYGMFFMFGSFDILMGIFVWLFVPETKGLSLEKMDELFGVTETVKRLDSARPASVGEEETHAG
KI*
Coding >Ophcf2|05344
ATGGCCCTCGTCAAGCTGCTGCGTTTGGCGGTCCGTAACGAGGCGATGCGGAGCGACCCGGTCGAGATTTACGGC
TGGCGCGTCTTCGCCCTCGTCTGCGCTGCCTGTTTCGGCGGCATGCTCTTCGGCTGGGAGACGGGCGCCATTGGC
GGCATCCTGGCCATGAAGCCTGCGCAGGATCGCTTCGGGACCTTGGGCGCTTCCAAGGCGGATCGATCCAATCTC
GATCAGAATATCGTGTCGACGTTGCAGGCTGGCTGCTTTGCTGCTTGCTTGGTTACGTCGTGGTTGACGGATCGG
TTTGGGAGGAAGAGCTGCCTTGTTGCCACGGGGGGGTTGGCGCTTGTTGGCGTTGTCATGCAGGCTGCTTCTGCT
ATCTCAGGGTCGCTGCCTGTCATGTACGTCGGCAGGTTTGTGGCTGGCTTGGGGGTCGGGGCGGCTTCGACCCTG
ACGCCCTTGTATGTGTCGGAGTGTGCGCCGAGGGCGATTCGGGGAGGGTTGACGGCCTTTTACCAGCTCTTCATC
GTCTGCGGCATCATGCTGGCCTTTTGGGTCAACTACGGCTGCGTCTTGCACGTTCCTTCGCCCGCAGTCTTTATC
CTGCCGTTGTCTCTGCAGGCGCTGCCAGCCGTCCTCCTCATCGTCGGCATGGCGTTGTCTCCCGAGAGTCCTCGC
TGGTGTGCCAGACAAGACGATTGGGAACGGACGACGAAAATTCTCGTCAGACTGCGAGGACTTCCTGCCGACTCG
GACTACGTCTCGGGCGAGATTCGCGAGATCGCTGACCAGCTCGAGGCTGAGCGACGGCTGATGGGAGACGCAACC
GCCCTTTCTCTTCTCAAGGAGATGGTGCTGATCCCGGGCAACCGTAACCGGGCCATTATTTCCGTCGTCCTCATG
ATTTGCCAGCAGATGACGGGCGTCAACGCCATCAACTATTACGCACCGCAGATCTTTCAGAACCTTGGCATGGAC
GGCACCAACACGTCACTGTTCGCCACGGGCGTATACGGCGTCGCCAAGACGGCTGCCTGCGCTGCATTTCTCGTC
TTCGTGGCCGATTCGCTGGGCCGCCGCTGGAGTTTGCTGTGGACCAGCGCTGCTCAGGCTTTCGTCTTGTTCGTC
ATTGGCATCTACGGGAGGGTACAGCCGCCGGTGCCGGGCCAGCCGGTCTCGGCCTTTGGATACGTGGCCATCGCC
TGCATATATCTTTGGGCAGCGGCGTTTCAGTTCGGATGGGGTCCGGCTTGTTGGATCCTCGTCAGCGAGATCCCC
ACGGCCCGGCTGCGTGCCATGAACGTCGCCCTCGCCGCGGCCGTGCAGTGGCTGTTTAACTTCGTCATGGCCCGG
ACTGTTCTGACGATGCAAAACACTATGGGGAGGGCCGGTTACGGTATGTTCTTCATGTTTGGCTCTTTCGACATT
CTCATGGGCATCTTTGTCTGGCTCTTCGTGCCCGAGACCAAGGGCCTCAGCCTGGAGAAGATGGACGAGCTGTTT
GGTGTGACGGAGACGGTCAAGCGGCTCGACAGCGCGCGTCCCGCGAGCGTGGGAGAGGAAGAGACACATGCCGGC
AAGATATGA
Transcript >Ophcf2|05344
ATGGCCCTCGTCAAGCTGCTGCGTTTGGCGGTCCGTAACGAGGCGATGCGGAGCGACCCGGTCGAGATTTACGGC
TGGCGCGTCTTCGCCCTCGTCTGCGCTGCCTGTTTCGGCGGCATGCTCTTCGGCTGGGAGACGGGCGCCATTGGC
GGCATCCTGGCCATGAAGCCTGCGCAGGATCGCTTCGGGACCTTGGGCGCTTCCAAGGCGGATCGATCCAATCTC
GATCAGAATATCGTGTCGACGTTGCAGGCTGGCTGCTTTGCTGCTTGCTTGGTTACGTCGTGGTTGACGGATCGG
TTTGGGAGGAAGAGCTGCCTTGTTGCCACGGGGGGGTTGGCGCTTGTTGGCGTTGTCATGCAGGCTGCTTCTGCT
ATCTCAGGGTCGCTGCCTGTCATGTACGTCGGCAGGTTTGTGGCTGGCTTGGGGGTCGGGGCGGCTTCGACCCTG
ACGCCCTTGTATGTGTCGGAGTGTGCGCCGAGGGCGATTCGGGGAGGGTTGACGGCCTTTTACCAGCTCTTCATC
GTCTGCGGCATCATGCTGGCCTTTTGGGTCAACTACGGCTGCGTCTTGCACGTTCCTTCGCCCGCAGTCTTTATC
CTGCCGTTGTCTCTGCAGGCGCTGCCAGCCGTCCTCCTCATCGTCGGCATGGCGTTGTCTCCCGAGAGTCCTCGC
TGGTGTGCCAGACAAGACGATTGGGAACGGACGACGAAAATTCTCGTCAGACTGCGAGGACTTCCTGCCGACTCG
GACTACGTCTCGGGCGAGATTCGCGAGATCGCTGACCAGCTCGAGGCTGAGCGACGGCTGATGGGAGACGCAACC
GCCCTTTCTCTTCTCAAGGAGATGGTGCTGATCCCGGGCAACCGTAACCGGGCCATTATTTCCGTCGTCCTCATG
ATTTGCCAGCAGATGACGGGCGTCAACGCCATCAACTATTACGCACCGCAGATCTTTCAGAACCTTGGCATGGAC
GGCACCAACACGTCACTGTTCGCCACGGGCGTATACGGCGTCGCCAAGACGGCTGCCTGCGCTGCATTTCTCGTC
TTCGTGGCCGATTCGCTGGGCCGCCGCTGGAGTTTGCTGTGGACCAGCGCTGCTCAGGCTTTCGTCTTGTTCGTC
ATTGGCATCTACGGGAGGGTACAGCCGCCGGTGCCGGGCCAGCCGGTCTCGGCCTTTGGATACGTGGCCATCGCC
TGCATATATCTTTGGGCAGCGGCGTTTCAGTTCGGATGGGGTCCGGCTTGTTGGATCCTCGTCAGCGAGATCCCC
ACGGCCCGGCTGCGTGCCATGAACGTCGCCCTCGCCGCGGCCGTGCAGTGGCTGTTTAACTTCGTCATGGCCCGG
ACTGTTCTGACGATGCAAAACACTATGGGGAGGGCCGGTTACGGTATGTTCTTCATGTTTGGCTCTTTCGACATT
CTCATGGGCATCTTTGTCTGGCTCTTCGTGCCCGAGACCAAGGGCCTCAGCCTGGAGAAGATGGACGAGCTGTTT
GGTGTGACGGAGACGGTCAAGCGGCTCGACAGCGCGCGTCCCGCGAGCGTGGGAGAGGAAGAGACACATGCCGGC
AAGATATGA
Gene >Ophcf2|05344
ATGGCCCTCGTCAAGCTGCTGCGTTTGGCGGTCCGTAACGAGGCGATGCGGAGCGACCCGGTCGAGATTTACGGC
TGGCGCGTCTTCGCCCTCGTCTGCGCTGCCTGTTTCGGCGGCATGCTCTTCGGCTGGGAGACGGGCGCCATTGGC
GGCATCCTGGCCATGAAGCCTGCGCAGGATCGCTTCGGGACCTTGGGCGCTTCCAAGGCGGATCGATCCAATCTC
GATCAGAATATCGTGTCGACGTTGCAGGCTGGCTGCTTTGCTGCTTGCTTGGTTACGTCGTGGTTGACGGATCGG
TTTGGGAGGAAGAGCTGCCTTGTTGCCACGGGGGGGTTGGCGCTTGTTGGCGTTGTCATGCAGGCTGCTTCTGCT
ATCTCAGGGTCGCTGCCTGTCATGTACGTCGGCAGGTTTGTGGCTGGCTTGGGGGTCGGGGCGGCTTCGACCCTG
ACGCCCTTGTATGTGTCGGAGTGTGCGCCGAGGGCGATTCGGGGAGGGTTGACGGGTGGGTTTATTCTTGCTGTT
GGTTGTGAGCGTGGACTGACTGACTGGTTTGAAGCCTTTTACCAGCTCTTCATCGTCTGCGGCATCATGCTGGCC
TTTTGGTTCGTCTTCTTATTCTTACCCAAGCTGACCTTGGTTGGTCATGGCTTACACGAGCCTCAGGGTCAACTA
CGGCTGCGTCTTGCACGTTCCTTCGCCCGCAGTCTTTATCCTGCCGTTGTCTCTGCAGGCGCTGCCAGCCGTGTG
AGTGTCTGTAGCGGCTCTGCGGGTGCGCACTCGACGACTGACTCGCCTCTAGCCTCCTCATCGTCGGCATGGCGT
TGTCTCCCGAGAGGTTAGTGAAGGAGAAAAATCACCATGATCAAGGCCCGCTGACAATCAACGACTCAGTCCTCG
CTGGTGTGCCAGACAAGACGATTGGGAACGGACGACGAAAATTCTCGTCAGACTGCGAGGGTAAGATGTCGTGAT
AACCTCTTCAAACGTTGCCTTTCGCTCAGCAGACGTAGACTTCCTGCCGACTCGGACTACGTCTCGGGCGAGATT
CGCGAGATCGCTGACCAGCTCGAGGCTGAGCGACGGCTGATGGGAGACGCAACCGCCCTTTCTCTTCTCAAGGAG
ATGGTGCTGATCCCGGGCAACCGTAACCGGGCCATTATTTCCGTCGTCCTCATGATTTGCCAGCAGATGACGGGC
GTCAACGCCATCGTGAGAAGCCGACCTCCTTTTTGAACTTGAGGAGCCAAATTTGCTGAGATGAGGCTCGTCTGC
CAGAACTATTACGCACCGCAGATCTTTCAGAACCTTGGCATGGACGGCACCAACACGTCACTGTTCGCCACGGGC
GTATACGGCGTCGCCAAGACGGCTGCCTGCGCTGCATTTCTCGTCTTCGTGGCCGATTCGCTGGGCCGCCGCTGG
AGTTTGCTGTGGACCAGCGCTGCTCAGGCTTTCGTCTTGTTCGTCATTGGCATCTACGGGAGGGTACAGCCGCCG
GTGCCGGGCCAGCCGGTGCGTACATGCATACTTACTCTCTTCATCTCTCATTCAGTATGACATGATCGGGGGCTG
ACGATGGAGATATCAGGTCTCGGCCTTTGGATACGTGGCCATCGCCTGCATATATCTTTGGGCAGCGTGCGTAGC
AAGACCGGCTCTCTGACTCGCGACTCGCGGGCTGACCGACTTCTAGGGCGTTTCAGTTCGGATGGGGTCCGGCTT
GTTGGATCCTCGTCAGCGAGATCCCCACGGCCCGGCTGCGTGCCATGAACGTCGCCCTCGCCGCGGCCGTGCAGT
GGCTGTTTAACTTCGTCATGGCCCGGAGTGAGCCTTTCTCCTTCCCGGCTGCTGGGCTGAACGGGCGTTGCTGAT
GACGATGATGTAGCTGTTCTGACGATGCAAAACACTATGGGGAGGGCCGGTTACGTACGTGTCATTCCGCAGCAA
CGGCTCGGGAGATGGAAACTGACTGAAGGTGGTATCGACAGGGTATGTTCTTCATGTTTGGCTCTTTCGACATTC
TCATGGGCATCTTTGTCTGGCTCTTCGTGCCCGAGACCAAGGGCCTCAGCCTGGAGAAGATGGACGAGCTGTTTG
GTGTGACGGAGACGGTCAAGCGGCTCGACAGCGCGCGTCCCGCGAGCGTGGGAGAGGAAGAGACACATGCCGGCA
AGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail