Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05342
Gene name
Locationscaffold_05:3353112..3361292
Strand-
Gene length (bp)8180
Transcript length (bp)6762
Coding sequence length (bp)6762
Protein length (aa) 2254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 0.0E+00 6 1289
PF00425 Chorismate_bind chorismate binding enzyme 8.9E-56 2043 2242
PF00117 GATase Glutamine amidotransferase class-I 2.1E-20 1316 1530
PF04715 Anth_synt_I_N Anthranilate synthase component I, N terminal region 1.5E-07 1623 1764

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6914 0.4634 0.1279 0.0759 0.2981 0.0463 0.1931 0.215 0.3545 0.1029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1934
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5747
Ophiocordyceps australis map64 (Brazil) OphauB2|8028
Ophiocordyceps camponoti-floridani Ophcf2|05342 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6870
Ophiocordyceps kimflemingae Ophio5|4916
Ophiocordyceps subramaniannii Hirsu2|207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05342
MSLDPLLPIAPARVSLLLVPFGRLRVANFASYVERLRTEQVVYLRDVGADGRPNRNMFSPLAFPDGAILYHLITH
MPPPSHLALSPFDLYREPLVVIALADGEELRNAVFVSTDSPVAASVADSNVSALHEELEKLRHVYPKALVYRAVI
FDYTPSEKDAPLPDGIVSVPPVQDCKRTTLKTVMCDVSSVLLAEMTTLAKSFEGMSAIQSPGQTTSLPKHGVEGS
GSGPGLGSGVVRRNSHFTVPQQDMRPSSATGLDSARQARMSMPPTTSPRPPINSTSSLPARPTTPTKGSLPSIPM
SPEDGQLELSPGPSRGDDRVSVQGFGVGSPNDRWRLRGKARTSVVVGSLFLQGGRWSDSLRELCDAASTARSLND
HVWHGKALELIVLNLLLLAWSGLGFQVPMVCLPPQEQRSTNAPPTIKVDKEGDAVEADGQKQPLHLRQLQAVLPE
LLDRIAGLYSKVSSESLPPLPQAEAIIRFSKILLAMHLCGGRLDAKALDMMTRGTKHEQRLTTSPRLGLVPTRQN
IVSLLFRAFPSSATELLTTTDRASVLCGMASVLGSLGYLRKRAMVMRELVSVLIGGLVEARTRGAADAGVHPAAG
LVSLTSGHDGTNGAVALDLAETDAEHGLEALLEHLCRSYGILGFGGEDDSDESAVARILDQSWARSFGLPGVKLN
ILRACINFSEALPDFYGVLKFSSDLLRAGGSGVAPGPRREDAAPLIHKDEQVRLATNVSRTAALVQRLGLGHLMA
EYWDEFLVRGIALEPLSEARTPVAHARGHLVGASIEVSSQGVNPFIYNPFLNKADEVAEQHLVAGETATFRVTLQ
NTYDVEVDIESVRLCSEGVELESWPERLTLGPYRTQLVRIRARPREPGSVRLTGAMIKVCGCRERRFPIFAKAWK
PATQDKIKVRGTSALETRTRTSSSNEAAPETKTVSFNVIAAQPLLVVKSTTLPQSAVMILEGERQTFSVTMRNAS
DVPVDLMLFSFTDATQAPLQEALGKRDATPAELYEYEFILSKRRALQLVDADENQNRGIAANGEATFDFEILGRP
GLTTATIQVDYTFLGAARDEVTTDRFFTRRVSVDLRVTVNASVELTRVDALSMEGRVPAPVWERLGQGVPEGAGD
EEYCLLCMDLRNAWPSLMAVRLEGEDGLAVEEKVLPGKTSRFVLPVKSIYMEGAHEPIPSLDPSRGRQFVVSTSR
PSPDMERANREAFWYRERLLDRVRATWRTTSSVPRRNGAIELRNMRLTPRMLEAMRIDEVAIDVTVEGGQSTGEG
RATAFVDDFLTLTETRTVKKRTTENNRAMALHETPPRRILFLDAYDSFTNNIVALLKHVLGHDLTVQVLHMDLKT
LDSDPSPDWTPEEFLARLPAFDAVVCGPGPGSPLRDADVGAFELLWRHGSVPVLGICLGFQSLVVHFGGGIRRLR
RRGLHGLVRLVEPVDERDVFRGVEAFGATLYHSLCADLGQDSVAEAEWESACRGRFACAPDLVPLAWTYEDGERI
LMAVRHAERPFWGIQYHPESIRTHHVAHRVVRNWFQAAIESNERMGRRRMDDLFSCIDSLDPSVRALNAAQLRMG
ACPWREDMRHGLAVEGIEPRYSCRRLELSQGVCAVDVAEGLGLDNCREAIILDSSSAARGDRLARNSVVALGVED
AVRLEYHVGDDHVTLRVPAGRDREERRQRIRLGVGRHGVDRSSPWDIMNEFWRRRRVDGEGGPVFKGGFLGFVTY
EMGLSTLSPGLVSGDRRHDRPDVCMAWITRSVLLDHEAGLAYVQNLGDDTGWMEAVARTVVAVRAGGGGEEAGFW
DNEKLLREVEGPGGETVVRRGGDRSRNDFEKHGGGNDGGEDDCRGDDGENGDWGNYDERNSVDDEHGKVNSNGGG
GGGGGGFDGVERGNWEDDDRLSRNGSRDEGGGNRVEEWRYGDGNLRDDFGLKRGGKNGNLRDDVGQDHGLDNSLD
NSNSDNSLDNSNSDDSPDNSNSDNSNSDNNTGHDHNCLNNCLNNSNFINNTGHDHSLNNCFNKLLNNCNYDNNTG
HNNTLNNSLENNTHHNHAPNSNTPWQIYRTLRTRQPAPFGTFIRLARATIIGSSPERFMHHSIQTGACSMRPMKG
TVRKSPTVATLAQAEALLHVPKEEAENVMIVDLVRHDLFSLCGVGGVSVRDLLRVEEFAGVWQMTTDVRGELPSG
TGETMTGFDVLAATLPPGSMTGAPKKRSCEMLASLEPSERSIYSGVIGYLDVGGGSDWSVTIRTIFRWEDEGEGG
EEV*
Coding >Ophcf2|05342
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCGAGAGTCAGCCTCCTGCTCGTTCCGTTCGGGAGGCTCAGG
GTCGCCAACTTCGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTGGCGCTGAT
GGCCGTCCGAATAGGAATATGTTTTCGCCGCTGGCGTTTCCTGATGGTGCTATTCTCTATCATCTCATTACCCAT
ATGCCGCCGCCGTCACACCTTGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCT
GACGGCGAGGAGCTACGGAATGCCGTCTTTGTATCGACAGATTCGCCAGTTGCCGCCTCCGTCGCAGACAGCAAC
GTCTCCGCCTTACACGAGGAGCTCGAGAAGCTGCGCCATGTCTATCCCAAGGCTCTCGTATACCGCGCCGTCATA
TTCGACTATACACCTTCCGAAAAGGACGCGCCTTTACCCGATGGTATCGTCTCCGTCCCACCTGTCCAAGATTGC
AAGCGCACGACGCTCAAGACGGTCATGTGCGACGTCTCCTCGGTACTCCTGGCCGAGATGACGACTCTGGCCAAG
TCTTTTGAGGGAATGTCTGCCATTCAGTCGCCGGGACAGACCACCTCTCTCCCCAAGCACGGTGTCGAGGGATCT
GGTTCGGGGCCGGGGCTGGGCAGCGGCGTTGTCAGGAGGAACTCGCACTTTACCGTTCCGCAACAGGATATGCGT
CCAAGCTCTGCTACCGGCTTGGACAGCGCCCGTCAGGCTCGCATGTCGATGCCCCCAACGACTTCGCCCAGACCC
CCCATCAACTCCACCAGTTCTCTTCCGGCGAGGCCCACGACGCCGACCAAGGGAAGTCTACCGAGCATCCCGATG
AGCCCCGAAGACGGACAGCTCGAACTGAGTCCCGGACCGAGTCGCGGAGACGATCGCGTATCCGTTCAGGGCTTC
GGCGTCGGCAGCCCCAACGATCGCTGGCGGCTACGGGGCAAGGCACGCACTTCGGTTGTCGTCGGCTCCCTGTTC
CTACAGGGCGGCCGCTGGAGCGACTCGCTCAGGGAGCTCTGTGATGCCGCCTCGACTGCGCGCTCGCTCAATGAC
CATGTCTGGCACGGAAAGGCGCTCGAGCTCATCGTCTTGAATCTCCTCTTGCTGGCCTGGTCCGGCCTGGGCTTT
CAGGTCCCCATGGTCTGCCTGCCTCCCCAGGAGCAGCGGTCAACCAACGCTCCTCCAACCATCAAGGTAGACAAG
GAGGGCGACGCGGTCGAAGCCGATGGCCAGAAGCAGCCGCTACACCTGAGACAGCTGCAAGCTGTTCTCCCGGAG
CTGCTGGACCGCATCGCCGGCTTGTACTCCAAGGTGTCGTCCGAGAGTCTGCCGCCGCTGCCTCAGGCTGAAGCC
ATCATCAGGTTCTCCAAGATTCTGCTGGCCATGCATCTCTGCGGTGGGAGGCTGGACGCAAAGGCGCTCGACATG
ATGACGCGCGGGACGAAGCACGAGCAGCGGCTGACGACGTCCCCGAGACTCGGACTCGTGCCTACGCGACAGAAC
ATCGTCAGCCTGCTTTTCAGGGCCTTTCCCTCGTCGGCGACGGAGCTCCTCACGACGACGGACCGCGCATCCGTT
CTGTGCGGCATGGCTTCCGTGCTCGGCTCGCTGGGCTACCTTCGCAAGAGGGCCATGGTGATGCGCGAACTGGTG
TCGGTCCTCATCGGGGGGCTCGTCGAAGCCCGGACGCGGGGCGCAGCCGATGCCGGCGTCCATCCTGCTGCCGGT
CTCGTGTCACTGACGTCGGGTCACGACGGGACAAACGGCGCAGTGGCCTTGGATCTGGCAGAGACGGACGCTGAA
CATGGGCTGGAGGCGCTGCTGGAGCATCTTTGTCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGACGATTCT
GACGAGTCTGCTGTTGCTCGCATCCTCGACCAGTCGTGGGCTCGGTCCTTTGGTCTTCCGGGCGTCAAGCTCAAC
ATTCTCCGCGCCTGTATCAACTTCTCCGAGGCACTGCCCGACTTTTACGGTGTACTCAAGTTCTCGTCCGATCTT
CTCCGGGCCGGGGGCTCCGGCGTTGCTCCAGGACCACGACGGGAAGATGCGGCGCCCCTGATTCACAAGGATGAA
CAGGTCCGGCTGGCGACCAACGTCTCCCGGACGGCGGCGCTGGTGCAGAGGCTGGGCTTGGGCCACCTCATGGCC
GAGTACTGGGACGAGTTTCTGGTCCGGGGCATCGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGGCACAC
GCTCGCGGCCATCTTGTCGGCGCCTCGATCGAGGTTTCGTCTCAGGGCGTGAATCCCTTCATATATAACCCGTTT
CTCAACAAGGCAGACGAGGTGGCTGAGCAGCATCTGGTGGCGGGTGAGACGGCTACTTTTAGAGTCACGCTGCAG
AATACGTACGACGTCGAGGTCGACATCGAGAGCGTCCGCCTCTGCAGCGAGGGCGTCGAGCTTGAGTCGTGGCCG
GAGCGGTTGACGCTCGGCCCGTACAGGACGCAGCTGGTGCGCATCCGGGCAAGGCCACGGGAGCCGGGTTCCGTT
CGGCTTACGGGAGCCATGATCAAGGTCTGCGGATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAG
CCGGCTACGCAGGATAAGATCAAGGTCCGTGGCACGTCTGCGCTGGAGACGAGGACGAGGACGTCGTCGTCGAAC
GAGGCGGCTCCGGAGACCAAGACGGTGAGCTTCAACGTCATTGCCGCGCAGCCGCTACTGGTGGTGAAATCGACT
ACGCTTCCGCAGTCGGCAGTCATGATTCTCGAGGGAGAGAGGCAGACGTTTTCCGTCACGATGCGTAACGCTTCG
GACGTGCCCGTCGACCTGATGCTCTTCTCCTTCACGGACGCGACGCAGGCGCCGCTTCAGGAGGCCCTCGGAAAA
CGAGACGCCACTCCGGCCGAACTCTACGAGTACGAGTTCATCCTCAGCAAGAGACGGGCTTTGCAGCTCGTCGAC
GCTGATGAGAATCAGAATCGCGGCATCGCGGCCAATGGCGAGGCCACCTTTGACTTTGAGATTCTCGGCAGGCCT
GGTCTGACGACGGCGACGATTCAGGTCGACTACACGTTTCTGGGCGCGGCGCGAGACGAGGTCACGACGGATCGA
TTCTTTACTCGGCGCGTCTCGGTCGATTTACGGGTGACGGTCAATGCCAGCGTGGAGCTGACGCGGGTTGATGCG
CTCTCGATGGAGGGGCGGGTTCCGGCTCCCGTGTGGGAGAGGCTGGGTCAGGGCGTGCCCGAGGGCGCCGGAGAT
GAAGAGTACTGCCTGCTGTGCATGGATCTGCGCAACGCGTGGCCGAGCCTCATGGCCGTCCGGCTCGAGGGCGAG
GACGGGCTGGCGGTGGAGGAAAAGGTGCTGCCGGGCAAGACGAGCCGGTTCGTGCTGCCGGTCAAGAGCATCTAC
ATGGAGGGGGCGCACGAGCCGATTCCGAGCTTGGATCCGTCACGGGGTCGACAGTTCGTCGTCAGCACCAGCAGG
CCATCGCCGGACATGGAACGGGCCAACCGCGAGGCATTCTGGTACCGCGAGAGGTTGCTGGACCGGGTGCGGGCC
ACGTGGCGGACGACGTCTTCGGTGCCGAGGCGGAACGGAGCCATTGAGCTGCGGAACATGCGGCTGACGCCCCGG
ATGCTGGAGGCGATGCGCATCGACGAGGTGGCCATTGACGTGACGGTCGAGGGCGGGCAGTCGACGGGCGAAGGC
AGGGCGACGGCGTTTGTCGACGACTTTTTGACGCTGACGGAGACGCGAACGGTGAAGAAACGCACGACTGAGAAT
AACAGAGCAATGGCTCTCCACGAAACACCGCCCAGACGCATCCTCTTCCTCGACGCCTACGATTCCTTCACAAAC
AACATCGTCGCCCTCCTCAAACATGTTCTCGGCCACGACCTCACAGTGCAGGTGCTGCACATGGATCTCAAGACG
CTCGACTCGGATCCCAGCCCGGACTGGACGCCGGAAGAGTTCCTCGCCCGATTGCCGGCCTTTGACGCCGTCGTC
TGCGGTCCCGGTCCCGGCTCTCCCCTCCGAGACGCCGACGTCGGAGCCTTCGAGCTTCTCTGGCGTCACGGCTCC
GTGCCGGTCTTGGGAATCTGCCTTGGTTTCCAGAGCCTGGTTGTTCATTTCGGGGGGGGGATTCGCAGGCTGAGA
CGGAGGGGGTTGCATGGGCTTGTTCGCCTTGTCGAGCCCGTCGATGAGCGTGATGTGTTTCGAGGGGTGGAGGCG
TTTGGTGCTACGCTTTACCATAGTCTCTGCGCTGATCTCGGTCAGGATTCTGTTGCTGAGGCGGAGTGGGAGTCT
GCTTGTCGGGGGAGGTTCGCCTGTGCGCCTGACCTCGTCCCTCTTGCGTGGACGTACGAAGACGGTGAGCGGATT
CTCATGGCCGTGAGACATGCCGAGAGGCCATTCTGGGGGATTCAGTATCATCCCGAGTCGATCCGGACGCATCAT
GTTGCTCATCGTGTTGTTCGAAATTGGTTTCAGGCTGCCATTGAGAGTAACGAGCGGATGGGAAGACGGAGGATG
GACGACTTGTTTTCCTGCATTGACAGCTTGGATCCCTCGGTGAGGGCCTTGAACGCTGCGCAGTTGCGGATGGGG
GCTTGTCCTTGGCGGGAGGATATGCGGCACGGGCTTGCGGTTGAGGGCATCGAGCCTCGATACTCGTGTCGACGG
CTGGAGTTGTCTCAGGGGGTTTGCGCTGTTGATGTTGCTGAGGGTTTGGGACTCGACAACTGCAGGGAAGCAATC
ATCCTTGACTCTTCCAGCGCGGCGAGGGGGGATCGACTCGCGAGGAATTCGGTCGTTGCGCTTGGCGTTGAGGAT
GCTGTTCGGTTGGAGTATCACGTCGGGGATGACCATGTTACTCTTCGCGTGCCGGCTGGAAGGGATCGAGAGGAA
CGAAGACAGAGAATCAGGTTGGGGGTTGGTCGTCATGGAGTTGACCGCTCGAGTCCGTGGGATATCATGAATGAG
TTTTGGAGGAGGAGACGGGTTGATGGGGAGGGAGGGCCGGTCTTCAAGGGCGGATTCCTCGGCTTCGTCACCTAT
GAGATGGGACTCAGCACTCTGAGTCCGGGTCTCGTCTCGGGGGATCGCCGACATGATCGACCGGACGTCTGCATG
GCGTGGATAACACGCAGCGTCCTCCTCGACCACGAAGCCGGCCTTGCATACGTGCAGAACCTGGGAGACGATACG
GGCTGGATGGAGGCCGTGGCGAGGACCGTTGTTGCCGTGAGGGCTGGGGGTGGAGGCGAAGAGGCGGGCTTTTGG
GACAATGAGAAGCTGTTGAGGGAGGTTGAGGGTCCTGGAGGTGAGACGGTTGTGAGGAGGGGTGGCGATCGGTCG
AGGAATGATTTCGAGAAGCACGGAGGGGGAAACGATGGCGGGGAGGATGACTGTCGAGGCGATGACGGTGAGAAC
GGTGACTGGGGGAACTACGATGAGAGGAACAGCGTCGACGATGAGCATGGCAAGGTTAACAGCAATGGCGGCGGC
GGCGGCGGCGGCGGCGGCTTCGACGGCGTTGAGAGGGGGAACTGGGAAGACGATGATCGACTCTCTCGGAATGGT
AGTCGTGATGAGGGCGGGGGGAATAGAGTCGAGGAGTGGAGGTACGGGGATGGCAACTTGAGAGACGATTTTGGT
CTCAAACGGGGCGGGAAGAATGGCAACTTGAGGGACGATGTGGGTCAAGACCACGGCCTCGACAACAGCCTCGAC
AACAGCAACTCTGACAACAGCCTCGACAACAGCAACTCTGACGATAGCCCCGACAACAGCAACTCTGACAACAGC
AACTCTGACAACAATACAGGTCACGACCACAACTGCCTCAACAACTGCCTCAACAACAGCAACTTTATCAACAAT
ACAGGTCACGACCACAGCCTCAACAACTGCTTCAACAAACTGCTCAACAATTGCAACTACGACAACAATACAGGT
CACAACAACACCCTCAACAACAGCCTCGAAAACAATACACACCACAACCACGCCCCAAACTCCAACACCCCCTGG
CAAATCTACCGCACCCTCCGCACCCGCCAACCCGCCCCCTTCGGCACCTTCATCCGCCTCGCCCGCGCAACCATC
ATCGGCAGCTCCCCCGAACGCTTCATGCATCACAGCATCCAAACAGGCGCCTGCTCCATGCGTCCCATGAAAGGC
ACCGTCCGCAAGTCCCCCACCGTCGCCACCCTCGCACAAGCCGAAGCCCTCCTCCACGTCCCCAAAGAGGAGGCA
GAGAACGTCATGATTGTCGATCTCGTGCGTCACGACCTCTTTTCCCTTTGCGGTGTCGGGGGCGTGAGCGTCAGG
GACCTGTTGAGGGTGGAGGAGTTTGCGGGCGTGTGGCAGATGACGACGGATGTTAGGGGGGAACTCCCCTCCGGA
ACTGGGGAGACTATGACGGGATTTGACGTCTTGGCTGCCACTCTACCACCTGGTAGCATGACGGGCGCACCCAAG
AAACGCAGCTGTGAGATGCTAGCATCTCTGGAACCGTCGGAAAGGAGCATCTACTCCGGTGTCATTGGCTACCTC
GACGTCGGGGGCGGCTCAGACTGGAGCGTGACGATCCGGACCATCTTCCGGTGGGAGGACGAGGGAGAAGGGGGG
GAGGAGGTTTGA
Transcript >Ophcf2|05342
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCGAGAGTCAGCCTCCTGCTCGTTCCGTTCGGGAGGCTCAGG
GTCGCCAACTTCGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTGGCGCTGAT
GGCCGTCCGAATAGGAATATGTTTTCGCCGCTGGCGTTTCCTGATGGTGCTATTCTCTATCATCTCATTACCCAT
ATGCCGCCGCCGTCACACCTTGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCT
GACGGCGAGGAGCTACGGAATGCCGTCTTTGTATCGACAGATTCGCCAGTTGCCGCCTCCGTCGCAGACAGCAAC
GTCTCCGCCTTACACGAGGAGCTCGAGAAGCTGCGCCATGTCTATCCCAAGGCTCTCGTATACCGCGCCGTCATA
TTCGACTATACACCTTCCGAAAAGGACGCGCCTTTACCCGATGGTATCGTCTCCGTCCCACCTGTCCAAGATTGC
AAGCGCACGACGCTCAAGACGGTCATGTGCGACGTCTCCTCGGTACTCCTGGCCGAGATGACGACTCTGGCCAAG
TCTTTTGAGGGAATGTCTGCCATTCAGTCGCCGGGACAGACCACCTCTCTCCCCAAGCACGGTGTCGAGGGATCT
GGTTCGGGGCCGGGGCTGGGCAGCGGCGTTGTCAGGAGGAACTCGCACTTTACCGTTCCGCAACAGGATATGCGT
CCAAGCTCTGCTACCGGCTTGGACAGCGCCCGTCAGGCTCGCATGTCGATGCCCCCAACGACTTCGCCCAGACCC
CCCATCAACTCCACCAGTTCTCTTCCGGCGAGGCCCACGACGCCGACCAAGGGAAGTCTACCGAGCATCCCGATG
AGCCCCGAAGACGGACAGCTCGAACTGAGTCCCGGACCGAGTCGCGGAGACGATCGCGTATCCGTTCAGGGCTTC
GGCGTCGGCAGCCCCAACGATCGCTGGCGGCTACGGGGCAAGGCACGCACTTCGGTTGTCGTCGGCTCCCTGTTC
CTACAGGGCGGCCGCTGGAGCGACTCGCTCAGGGAGCTCTGTGATGCCGCCTCGACTGCGCGCTCGCTCAATGAC
CATGTCTGGCACGGAAAGGCGCTCGAGCTCATCGTCTTGAATCTCCTCTTGCTGGCCTGGTCCGGCCTGGGCTTT
CAGGTCCCCATGGTCTGCCTGCCTCCCCAGGAGCAGCGGTCAACCAACGCTCCTCCAACCATCAAGGTAGACAAG
GAGGGCGACGCGGTCGAAGCCGATGGCCAGAAGCAGCCGCTACACCTGAGACAGCTGCAAGCTGTTCTCCCGGAG
CTGCTGGACCGCATCGCCGGCTTGTACTCCAAGGTGTCGTCCGAGAGTCTGCCGCCGCTGCCTCAGGCTGAAGCC
ATCATCAGGTTCTCCAAGATTCTGCTGGCCATGCATCTCTGCGGTGGGAGGCTGGACGCAAAGGCGCTCGACATG
ATGACGCGCGGGACGAAGCACGAGCAGCGGCTGACGACGTCCCCGAGACTCGGACTCGTGCCTACGCGACAGAAC
ATCGTCAGCCTGCTTTTCAGGGCCTTTCCCTCGTCGGCGACGGAGCTCCTCACGACGACGGACCGCGCATCCGTT
CTGTGCGGCATGGCTTCCGTGCTCGGCTCGCTGGGCTACCTTCGCAAGAGGGCCATGGTGATGCGCGAACTGGTG
TCGGTCCTCATCGGGGGGCTCGTCGAAGCCCGGACGCGGGGCGCAGCCGATGCCGGCGTCCATCCTGCTGCCGGT
CTCGTGTCACTGACGTCGGGTCACGACGGGACAAACGGCGCAGTGGCCTTGGATCTGGCAGAGACGGACGCTGAA
CATGGGCTGGAGGCGCTGCTGGAGCATCTTTGTCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGACGATTCT
GACGAGTCTGCTGTTGCTCGCATCCTCGACCAGTCGTGGGCTCGGTCCTTTGGTCTTCCGGGCGTCAAGCTCAAC
ATTCTCCGCGCCTGTATCAACTTCTCCGAGGCACTGCCCGACTTTTACGGTGTACTCAAGTTCTCGTCCGATCTT
CTCCGGGCCGGGGGCTCCGGCGTTGCTCCAGGACCACGACGGGAAGATGCGGCGCCCCTGATTCACAAGGATGAA
CAGGTCCGGCTGGCGACCAACGTCTCCCGGACGGCGGCGCTGGTGCAGAGGCTGGGCTTGGGCCACCTCATGGCC
GAGTACTGGGACGAGTTTCTGGTCCGGGGCATCGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGGCACAC
GCTCGCGGCCATCTTGTCGGCGCCTCGATCGAGGTTTCGTCTCAGGGCGTGAATCCCTTCATATATAACCCGTTT
CTCAACAAGGCAGACGAGGTGGCTGAGCAGCATCTGGTGGCGGGTGAGACGGCTACTTTTAGAGTCACGCTGCAG
AATACGTACGACGTCGAGGTCGACATCGAGAGCGTCCGCCTCTGCAGCGAGGGCGTCGAGCTTGAGTCGTGGCCG
GAGCGGTTGACGCTCGGCCCGTACAGGACGCAGCTGGTGCGCATCCGGGCAAGGCCACGGGAGCCGGGTTCCGTT
CGGCTTACGGGAGCCATGATCAAGGTCTGCGGATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAG
CCGGCTACGCAGGATAAGATCAAGGTCCGTGGCACGTCTGCGCTGGAGACGAGGACGAGGACGTCGTCGTCGAAC
GAGGCGGCTCCGGAGACCAAGACGGTGAGCTTCAACGTCATTGCCGCGCAGCCGCTACTGGTGGTGAAATCGACT
ACGCTTCCGCAGTCGGCAGTCATGATTCTCGAGGGAGAGAGGCAGACGTTTTCCGTCACGATGCGTAACGCTTCG
GACGTGCCCGTCGACCTGATGCTCTTCTCCTTCACGGACGCGACGCAGGCGCCGCTTCAGGAGGCCCTCGGAAAA
CGAGACGCCACTCCGGCCGAACTCTACGAGTACGAGTTCATCCTCAGCAAGAGACGGGCTTTGCAGCTCGTCGAC
GCTGATGAGAATCAGAATCGCGGCATCGCGGCCAATGGCGAGGCCACCTTTGACTTTGAGATTCTCGGCAGGCCT
GGTCTGACGACGGCGACGATTCAGGTCGACTACACGTTTCTGGGCGCGGCGCGAGACGAGGTCACGACGGATCGA
TTCTTTACTCGGCGCGTCTCGGTCGATTTACGGGTGACGGTCAATGCCAGCGTGGAGCTGACGCGGGTTGATGCG
CTCTCGATGGAGGGGCGGGTTCCGGCTCCCGTGTGGGAGAGGCTGGGTCAGGGCGTGCCCGAGGGCGCCGGAGAT
GAAGAGTACTGCCTGCTGTGCATGGATCTGCGCAACGCGTGGCCGAGCCTCATGGCCGTCCGGCTCGAGGGCGAG
GACGGGCTGGCGGTGGAGGAAAAGGTGCTGCCGGGCAAGACGAGCCGGTTCGTGCTGCCGGTCAAGAGCATCTAC
ATGGAGGGGGCGCACGAGCCGATTCCGAGCTTGGATCCGTCACGGGGTCGACAGTTCGTCGTCAGCACCAGCAGG
CCATCGCCGGACATGGAACGGGCCAACCGCGAGGCATTCTGGTACCGCGAGAGGTTGCTGGACCGGGTGCGGGCC
ACGTGGCGGACGACGTCTTCGGTGCCGAGGCGGAACGGAGCCATTGAGCTGCGGAACATGCGGCTGACGCCCCGG
ATGCTGGAGGCGATGCGCATCGACGAGGTGGCCATTGACGTGACGGTCGAGGGCGGGCAGTCGACGGGCGAAGGC
AGGGCGACGGCGTTTGTCGACGACTTTTTGACGCTGACGGAGACGCGAACGGTGAAGAAACGCACGACTGAGAAT
AACAGAGCAATGGCTCTCCACGAAACACCGCCCAGACGCATCCTCTTCCTCGACGCCTACGATTCCTTCACAAAC
AACATCGTCGCCCTCCTCAAACATGTTCTCGGCCACGACCTCACAGTGCAGGTGCTGCACATGGATCTCAAGACG
CTCGACTCGGATCCCAGCCCGGACTGGACGCCGGAAGAGTTCCTCGCCCGATTGCCGGCCTTTGACGCCGTCGTC
TGCGGTCCCGGTCCCGGCTCTCCCCTCCGAGACGCCGACGTCGGAGCCTTCGAGCTTCTCTGGCGTCACGGCTCC
GTGCCGGTCTTGGGAATCTGCCTTGGTTTCCAGAGCCTGGTTGTTCATTTCGGGGGGGGGATTCGCAGGCTGAGA
CGGAGGGGGTTGCATGGGCTTGTTCGCCTTGTCGAGCCCGTCGATGAGCGTGATGTGTTTCGAGGGGTGGAGGCG
TTTGGTGCTACGCTTTACCATAGTCTCTGCGCTGATCTCGGTCAGGATTCTGTTGCTGAGGCGGAGTGGGAGTCT
GCTTGTCGGGGGAGGTTCGCCTGTGCGCCTGACCTCGTCCCTCTTGCGTGGACGTACGAAGACGGTGAGCGGATT
CTCATGGCCGTGAGACATGCCGAGAGGCCATTCTGGGGGATTCAGTATCATCCCGAGTCGATCCGGACGCATCAT
GTTGCTCATCGTGTTGTTCGAAATTGGTTTCAGGCTGCCATTGAGAGTAACGAGCGGATGGGAAGACGGAGGATG
GACGACTTGTTTTCCTGCATTGACAGCTTGGATCCCTCGGTGAGGGCCTTGAACGCTGCGCAGTTGCGGATGGGG
GCTTGTCCTTGGCGGGAGGATATGCGGCACGGGCTTGCGGTTGAGGGCATCGAGCCTCGATACTCGTGTCGACGG
CTGGAGTTGTCTCAGGGGGTTTGCGCTGTTGATGTTGCTGAGGGTTTGGGACTCGACAACTGCAGGGAAGCAATC
ATCCTTGACTCTTCCAGCGCGGCGAGGGGGGATCGACTCGCGAGGAATTCGGTCGTTGCGCTTGGCGTTGAGGAT
GCTGTTCGGTTGGAGTATCACGTCGGGGATGACCATGTTACTCTTCGCGTGCCGGCTGGAAGGGATCGAGAGGAA
CGAAGACAGAGAATCAGGTTGGGGGTTGGTCGTCATGGAGTTGACCGCTCGAGTCCGTGGGATATCATGAATGAG
TTTTGGAGGAGGAGACGGGTTGATGGGGAGGGAGGGCCGGTCTTCAAGGGCGGATTCCTCGGCTTCGTCACCTAT
GAGATGGGACTCAGCACTCTGAGTCCGGGTCTCGTCTCGGGGGATCGCCGACATGATCGACCGGACGTCTGCATG
GCGTGGATAACACGCAGCGTCCTCCTCGACCACGAAGCCGGCCTTGCATACGTGCAGAACCTGGGAGACGATACG
GGCTGGATGGAGGCCGTGGCGAGGACCGTTGTTGCCGTGAGGGCTGGGGGTGGAGGCGAAGAGGCGGGCTTTTGG
GACAATGAGAAGCTGTTGAGGGAGGTTGAGGGTCCTGGAGGTGAGACGGTTGTGAGGAGGGGTGGCGATCGGTCG
AGGAATGATTTCGAGAAGCACGGAGGGGGAAACGATGGCGGGGAGGATGACTGTCGAGGCGATGACGGTGAGAAC
GGTGACTGGGGGAACTACGATGAGAGGAACAGCGTCGACGATGAGCATGGCAAGGTTAACAGCAATGGCGGCGGC
GGCGGCGGCGGCGGCGGCTTCGACGGCGTTGAGAGGGGGAACTGGGAAGACGATGATCGACTCTCTCGGAATGGT
AGTCGTGATGAGGGCGGGGGGAATAGAGTCGAGGAGTGGAGGTACGGGGATGGCAACTTGAGAGACGATTTTGGT
CTCAAACGGGGCGGGAAGAATGGCAACTTGAGGGACGATGTGGGTCAAGACCACGGCCTCGACAACAGCCTCGAC
AACAGCAACTCTGACAACAGCCTCGACAACAGCAACTCTGACGATAGCCCCGACAACAGCAACTCTGACAACAGC
AACTCTGACAACAATACAGGTCACGACCACAACTGCCTCAACAACTGCCTCAACAACAGCAACTTTATCAACAAT
ACAGGTCACGACCACAGCCTCAACAACTGCTTCAACAAACTGCTCAACAATTGCAACTACGACAACAATACAGGT
CACAACAACACCCTCAACAACAGCCTCGAAAACAATACACACCACAACCACGCCCCAAACTCCAACACCCCCTGG
CAAATCTACCGCACCCTCCGCACCCGCCAACCCGCCCCCTTCGGCACCTTCATCCGCCTCGCCCGCGCAACCATC
ATCGGCAGCTCCCCCGAACGCTTCATGCATCACAGCATCCAAACAGGCGCCTGCTCCATGCGTCCCATGAAAGGC
ACCGTCCGCAAGTCCCCCACCGTCGCCACCCTCGCACAAGCCGAAGCCCTCCTCCACGTCCCCAAAGAGGAGGCA
GAGAACGTCATGATTGTCGATCTCGTGCGTCACGACCTCTTTTCCCTTTGCGGTGTCGGGGGCGTGAGCGTCAGG
GACCTGTTGAGGGTGGAGGAGTTTGCGGGCGTGTGGCAGATGACGACGGATGTTAGGGGGGAACTCCCCTCCGGA
ACTGGGGAGACTATGACGGGATTTGACGTCTTGGCTGCCACTCTACCACCTGGTAGCATGACGGGCGCACCCAAG
AAACGCAGCTGTGAGATGCTAGCATCTCTGGAACCGTCGGAAAGGAGCATCTACTCCGGTGTCATTGGCTACCTC
GACGTCGGGGGCGGCTCAGACTGGAGCGTGACGATCCGGACCATCTTCCGGTGGGAGGACGAGGGAGAAGGGGGG
GAGGAGGTTTGA
Gene >Ophcf2|05342
ATGAGCCTCGATCCCCTGCTGCCCATCGCCCCCGCGAGAGTCAGCCTCCTGCTCGTTCCGTTCGGGAGGCTCAGG
GTCGCCAACTTCGCTTCCTACGTTGAGAGGCTTCGGACGGAGCAGGTCGTCTACCTGCGCGACGTTGGCGCTGAT
GGCCGTCCGAATAGGAGTGAGTGCTTCGCGAGGGAGGATGGGGGAAATAAGGAGAGGGCTGATCTTGTTCTAGAT
ATGTTTTCGCCGCTGGCGTTTCCTGATGGTGCTATTCTCTATCATCTCATTACCCATATGCCGCCGCCGTCACAC
CTTGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCGCTCGTTGTCATCGCCCTTGCTGACGGCGAGGAGCTACGG
AATGCCGTCTTTGTATCGACAGATTCGCCAGTTGCCGCCTCCGTCGCAGACAGCAACGTCTCCGCCTTACACGAG
GAGCTCGAGAAGCTGCGCCATGTCTATCCCAAGGCTCTCGTATACCGCGCCGTCATATTCGACTATACACCTTCC
GAAAAGGACGCGCCTTTACCCGATGGTATCGTCTCCGTCCCACCTGTCCAAGATTGCAAGCGCACGACGCTCAAG
ACGGTCATGTGCGACGTCTCCTCGGTACTCCTGGCCGAGATGACGACTCTGGCCAAGTCTTTTGAGGGAATGTCT
GCCATTCAGTCGCCGGGACAGACCACCTCTCTCCCCAAGCACGGTGTCGAGGGATCTGGTTCGGGGCCGGGGCTG
GGCAGCGGCGTTGTCAGGAGGAACTCGCACTTTACCGTTCCGCAACAGGATATGCGTCCAAGCTCTGCTACCGGC
TTGGACAGCGCCCGTCAGGCTCGCATGTCGATGCCCCCAACGACTTCGCCCAGACCCCCCATCAACTCCACCAGT
TCTCTTCCGGCGAGGCCCACGACGCCGACCAAGGGAAGTCTACCGAGCATCCCGATGAGCCCCGAAGACGGACAG
CTCGAACTGAGTCCCGGACCGAGTCGCGGAGACGATCGCGTATCCGTTCAGGGCTTCGGCGTCGGCAGCCCCAAC
GATCGCTGGCGGCTACGGGGCAAGGCACGCACTTCGGTTGTCGTCGGCTCCCTGTTCCTACAGGGCGGCCGCTGG
AGCGACTCGCTCAGGGAGCTCTGTGATGCCGCCTCGACTGCGCGCTCGCTCAATGACCATGTCTGGCACGGAAAG
GCGCTCGAGCTCATCGTCTTGAATCTCCTCTTGCTGGCCTGGTCCGGCCTGGGCTTTCAGGTCCCCATGGTCTGC
CTGCCTCCCCAGGAGCAGCGGTCAACCAACGCTCCTCCAACCATCAAGGTAGACAAGGAGGGCGACGCGGTCGAA
GCCGATGGCCAGAAGCAGCCGCTACACCTGAGACAGCTGCAAGCTGTTCTCCCGGAGCTGCTGGACCGCATCGCC
GGCTTGTACTCCAAGGTGTCGTCCGAGAGTCTGCCGCCGCTGCCTCAGGCTGAAGCCATCATCAGGTTCTCCAAG
ATTCTGCTGGCCATGCATCTCTGCGGTGGGAGGCTGGACGCAAAGGCGCTCGACATGATGACGCGCGGGACGAAG
CACGAGCAGCGGCTGACGACGTCCCCGAGACTCGGACTCGTGCCTACGCGACAGAACATCGTCAGCCTGCTTTTC
AGGGCCTTTCCCTCGTCGGCGACGGAGCTCCTCACGACGACGGACCGCGCATCCGTTCTGTGCGGCATGGCTTCC
GTGCTCGGCTCGCTGGGCTACCTTCGCAAGAGGGCCATGGTGATGCGCGAACTGGTGTCGGTCCTCATCGGGGGG
CTCGTCGAAGCCCGGACGCGGGGCGCAGCCGATGCCGGCGTCCATCCTGCTGCCGGTCTCGTGTCACTGACGTCG
GGTCACGACGGGACAAACGGCGCAGTGGCCTTGGATCTGGCAGAGACGGACGCTGAACATGGGCTGGAGGCGCTG
CTGGAGCATCTTTGTCGCTCGTACGGCATCTTGGGCTTTGGCGGCGAGGACGATTCTGACGAGTCTGCTGTTGCT
CGCATCCTCGACCAGTCGTGGGCTCGGTCCTTTGGTCTTCCGGGCGTCAAGCTCAACATTCTCCGCGCCTGTATC
AACTTCTCCGAGGCACTGCCCGACTTTTACGGTGTACTCAAGTTCTCGTCCGATCTTCTCCGGGCCGGGGGCTCC
GGCGTTGCTCCAGGACCACGACGGGAAGATGCGGCGCCCCTGATTCACAAGGATGAACAGGTCCGGCTGGCGACC
AACGTCTCCCGGACGGCGGCGCTGGTGCAGAGGCTGGGCTTGGGCCACCTCATGGCCGAGTACTGGGACGAGTTT
CTGGTCCGGGGCATCGCGTTGGAGCCGCTGTCGGAGGCGCGTACGCCGGTGGCACACGCTCGCGGCCATCTTGTC
GGCGCCTCGATCGAGGTTTCGTCTCAGGGCGTGAATCCCTTCATATATAACCCGTTTCTCAACAAGGCAGACGAG
GTGGCTGAGCAGCATCTGGTGGCGGGTGAGACGGCTACTTTTAGAGTCACGCTGCAGAATACGTACGACGTCGAG
GTCGACATCGAGAGCGTCCGCCTCTGCAGCGAGGGCGTCGAGCTTGAGTCGTGGCCGGAGCGGTTGACGCTCGGC
CCGTACAGGACGCAGCTGGTGCGCATCCGGGCAAGGCCACGGGAGCCGGGTTCCGTTCGGCTTACGGGAGCCATG
ATCAAGGTCTGCGGATGCAGGGAGAGGCGATTCCCCATCTTCGCCAAGGCTTGGAAGCCGGCTACGCAGGATAAG
ATCAAGGTCCGTGGCACGTCTGCGCTGGAGACGAGGACGAGGACGTCGTCGTCGAACGAGGCGGCTCCGGAGACC
AAGACGGTGAGCTTCAACGTCATTGCCGCGCAGCCGCTACTGGTGGTGAAATCGACTACGCTTCCGCAGTCGGCA
GTCATGATTCTCGAGGGAGAGAGGCAGACGTTTTCCGTCACGATGCGTAACGCTTCGGACGTGCCCGTCGACCTG
ATGCTCTTCTCCTTCACGGACGCGACGCAGGCGCCGCTTCAGGAGGCCCTCGGAAAACGAGACGCCACTCCGGCC
GAACTCTACGAGTACGAGTTCATCCTCAGCAAGAGACGGGCTTTGCAGCTCGTCGACGCTGATGAGAATCAGAAT
CGCGGCATCGCGGCCAATGGCGAGGCCACCTTTGACTTTGAGATTCTCGGCAGGCCTGGTCTGACGACGGCGACG
ATTCAGGTCGACTACACGTTTCTGGGCGCGGCGCGAGACGAGGTCACGACGGATCGATTCTTTACTCGGCGCGTC
TCGGTCGATTTACGGGTGACGGTCAATGCCAGCGTGGAGCTGACGCGGGTTGATGCGCTCTCGATGGAGGGGCGG
GTTCCGGCTCCCGTGTGGGAGAGGCTGGGTCAGGGCGTGCCCGAGGGCGCCGGAGATGAAGAGTACTGCCTGCTG
TGCATGGATCTGCGCAACGCGTGGCCGAGCCTCATGGCCGTCCGGCTCGAGGGCGAGGACGGGCTGGCGGTGGAG
GAAAAGGTGCTGCCGGGCAAGACGAGCCGGTTCGTGCTGCCGGTCAAGAGCATCTACATGGAGGGGGCGCACGAG
CCGATTCCGAGCTTGGATCCGTCACGGGGTCGACAGTTCGTCGTCAGCACCAGCAGGCCATCGCCGGACATGGAA
CGGGCCAACCGCGAGGCATTCTGGTACCGCGAGAGGTTGCTGGACCGGGTGCGGGCCACGTGGCGGACGACGTCT
TCGGTGCCGAGGCGGAACGGAGCCATTGAGCTGCGGAACATGCGGCTGACGCCCCGGATGCTGGAGGCGATGCGC
ATCGACGAGGTGGCCATTGACGTGACGGTCGAGGGCGGGCAGTCGACGGGCGAAGGCAGGGCGACGGCGTTTGTC
GACGACTTTTTGACGCTGACGGTGCGCGTGACGAACCGGACGTCGTCCAAGATGTATCCCTTGCTCCGGCTGCTC
CCGGCGCTGTGTCACCGACCGACCATGGTGGCGCTGGACCACACGCGCAAGCTGGCCTGGAACGGGACGCTGCAG
CAGCTGCTACCAGCCATCCAAGCCCACGACTCGACGAGCTTCAGCATCGGAATGACGGCACTGTGTCGAGGAGAG
TTTGAGATGGGCGCTTCGGTCGAGGAGGTTTGGACGCAGGAGGAAGAGACGACGACGAAGGAGGACGGGGGGAGG
AGCATGGTGGTGGATGCGGCGCTGGGGGTGAGACAGCGGAGGATGTGGCATTCGAGGAGGCCTTTTGTGTTGGCG
GTGAAGGATGGAGATGAGTAGATGGGCTTGTTCGGCGCTGGTAGCATCGACGGAGTTGGCTGCTAAGAGTTGATG
ATGATGATGATGATGATGATGATGATGATGATGATTTTGAAGCGGTGAGTGACGTCTTCTCTCTGGGACTGTTGT
GGATGGGATGCCTGGGGTGTGGTTGGAGATTGGTGCTAATTATAGAAGGCCGGAGCCGGGGAATACTTTGAGCGG
CGCTACTGGTGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCCAGTTTAATATTCGCATGTAGGGCC
ATGCTCGTTTCGGACGACGGATCGGAGCGATGGCAAGACTATGAATCATTGACTGTTGAAAGGGCTTGTCTTTTC
TAATGATGGGAGGTCTTTAGCTGATTGGTAGGATGGTGTTTGATTGAGGTTGTGCGTTTCACTGCTTGAGGATTG
AAGCCGCGACAGCGACGGAGCGCGGAGATCGAGTTTGAGACTTGGAGAGGGGGAGAGGGAGGGAGAGAGCAAGGG
AAGAGAACATACATGACGTGGAGGATCGAGAGGGGAGGAGACAGATTGAAGAGAAGGAGGCAAGATAAGACAAGG
ACGGGGATATTGCGTGTGGGTTGAGGAGACGCGAACGGTGAGGATATACCGGGCGAGGAAACTCGTGACGGAGAA
TGCCGGGCGAGAAAACGCTTGACTGAGAATACCAGGTGAAGAAACGCACGACTGAGAATAACAGGTGAGGAAAGA
CGCCAGAGACAACTCTAGGCAACTCAACACACATCAGAACACACCACAGACTACCCCAGGCAATAGAACACGGCG
CAGAGAATACCAGGCATAATAATACACAGCATAGAATACGCCAGGCAACAAAACACACCCCTTACTACTCCAGGC
CAAACCCAGAGCAATGGCTCTCCACGAAACACCGCCCAGACGCATCCTCTTCCTCGACGCCTACGATTCCTTCAC
AAACAACATCGTCGCCCTCCTCAAACATGTTCTCGGCCACGACCTCACAGTGCAGGTGCTGCACATGGATCTCAA
GACGCTCGACTCGGATCCCAGCCCGGACTGGACGCCGGAAGAGTTCCTCGCCCGATTGCCGGCCTTTGACGCCGT
CGTCTGCGGTCCCGGTCCCGGCTCTCCCCTCCGAGACGCCGACGTCGGAGCCTTCGAGCTTCTCTGGCGTCACGG
CTCCGTGCCGGTCTTGGGAATCTGCCTTGGTTTCCAGAGCCTGGTTGTTCATTTCGGGGGGGGGATTCGCAGGCT
GAGACGGAGGGGGTTGCATGGGCTTGTTCGCCTTGTCGAGCCCGTCGATGAGCGTGATGTGTTTCGAGGGGTGGA
GGCGTTTGGTGCTACGCTTTACCATAGTCTCTGCGCTGATCTCGGTCAGGATTCTGTTGCTGAGGCGGAGTGGGA
GTCTGCTTGTCGGGGGAGGTTCGCCTGTGCGCCTGACCTCGTCCCTCTTGCGTGGACGTACGAAGACGGTGAGCG
GATTCTCATGGCCGTGAGACATGCCGAGAGGCCATTCTGGGGGATTCAGTATCATCCCGAGTCGATCCGGACGCA
TCATGTTGCTCATCGTGTTGTTCGAAATTGGTTTCAGGCTGCCATTGAGAGTAACGAGCGGATGGGAAGACGGAG
GATGGACGACTTGTTTTCCTGCATTGACAGCTTGGATCCCTCGGTGAGGGCCTTGAACGCTGCGCAGTTGCGGAT
GGGGGCTTGTCCTTGGCGGGAGGATATGCGGCACGGGCTTGCGGTTGAGGGCATCGAGCCTCGATACTCGTGTCG
ACGGCTGGAGTTGTCTCAGGGGGTTTGCGCTGTTGATGTTGCTGAGGGTTTGGGACTCGACAACTGCAGGGAAGC
AATCATCCTTGACTCTTCCAGCGCGGCGAGGGGGGATCGACTCGCGAGGAATTCGGTCGTTGCGCTTGGCGTTGA
GGATGCTGTTCGGTTGGAGTATCACGTCGGGGATGACCATGTTACTCTTCGCGTGCCGGCTGGAAGGGATCGAGA
GGAACGAAGACAGAGAATCAGGTTGGGGGTTGGTCGTCATGGAGTTGACCGCTCGAGTCCGTGGGATATCATGAA
TGAGTTTTGGAGGAGGAGACGGGTTGATGGGGAGGGAGGGCCGGTCTTCAAGGGCGGATTCCTCGGCTTCGTCAC
CTATGAGATGGGACTCAGCACTCTGAGTCCGGGTCTCGTCTCGGGGGATCGCCGACATGATCGACCGGACGTCTG
CATGGCGTGGATAACACGCAGCGTCCTCCTCGACCACGAAGCCGGCCTTGCATACGTGCAGAACCTGGGAGACGA
TACGGGCTGGATGGAGGCCGTGGCGAGGACCGTTGTTGCCGTGAGGGCTGGGGGTGGAGGCGAAGAGGCGGGCTT
TTGGGACAATGAGAAGCTGTTGAGGGAGGTTGAGGGTCCTGGAGGTGAGGTTCGGGGTCCCGGGAAGGGGTATGA
GGGGATGTGAGGAGGTGTCAGGGATGATTCGGGAGGGGGAGAGTTATGAGTTGTGTCTTACGGCGCAGACGGTTG
TGAGGAGGGGTGGCGATCGGTCGAGGAATGATTTCGAGAAGCACGGAGGGGGAAACGATGGCGGGGAGGATGACT
GTCGAGGCGATGACGGTGAGAACGGTGACTGGGGGAACTACGATGAGAGGAACAGCGTCGACGATGAGCATGGCA
AGGTTAACAGCAATGGCGGCGGCGGCGGCGGCGGCGGCGGCTTCGACGGCGTTGAGAGGGGGAACTGGGAAGACG
ATGATCGACTCTCTCGGAATGGTAGTCGTGATGAGGGCGGGGGGAATAGAGTCGAGGAGTGGAGGTACGGGGATG
GCAACTTGAGAGACGATTTTGGTCTCAAACGGGGCGGGAAGAATGGCAACTTGAGGGACGATGTGGGTCAAGACC
ACGGCCTCGACAACAGCCTCGACAACAGCAACTCTGACAACAGCCTCGACAACAGCAACTCTGACGATAGCCCCG
ACAACAGCAACTCTGACAACAGCAACTCTGACAACAATACAGGTCACGACCACAGCCTCAACAACAGCAACTCTA
TCAACAATGCAGGTCACGACCACAACTGCCTCAACAACTGCCTCAACAACAGCAACTTTATCAACAATACAGGTC
ACGACCACAGCCTCAACAACTGCTTCAACAAACTGCTCAACAATTGCAACTACGACAACAATACAGGTCACAACA
ACACCCTCAACAACAGCCTCGAAAACAATACACACCACAACCACGCCCCAAACTCCAACACCCCCTGGCAAATCT
ACCGCACCCTCCGCACCCGCCAACCCGCCCCCTTCGGCACCTTCATCCGCCTCGCCCGCGCAACCATCATCGGCA
GCTCCCCCGAACGCTTCATGCATCACAGCATCCAAACAGGCGCCTGCTCCATGCGTCCCATGAAAGGCACCGTCC
GCAAGTCCCCCACCGTCGCCACCCTCGCACAAGCCGAAGCCCTCCTCCACGTCCCCAAAGAGGAGGCAGAGAACG
TCATGATTGTCGATCTCGTGCGTCACGACCTCTTTTCCCTTTGCGGTGTCGGGGGCGTGAGCGTCAGGGACCTGT
TGAGGGTGGAGGAGTTTGCGGGCGTGTGGCAGATGACGACGGATGTTAGGGGGGAACTCCCCTCCGGAACTGGGG
AGACTATGACGGGATTTGACGTCTTGGCTGCCACTCTACCACCTGGTAGCATGACGGGCGCACCCAAGAAACGCA
GCTGTGAGATGCTAGCATCTCTGGAACCGTCGGAAAGGAGCATCTACTCCGGTGTCATTGGCTACCTCGACGTCG
GGGGCGGCTCAGACTGGAGCGTGACGATCCGGACCATCTTCCGGTGGGAGGACGAGGGAGAAGGGGGGGAGGAGG
TTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail