Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05338
Gene name
Locationscaffold_05:3346506..3349480
Strand+
Gene length (bp)2974
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.1E-11 417 507

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus 0.3957 0.4289 0.0761 0.0786 0.1372 0.0204 0.3037 0.3624 0.5049 0.0383

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1497
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4915
Ophiocordyceps australis map64 (Brazil) OphauB2|1665
Ophiocordyceps camponoti-floridani Ophcf2|05338 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|211
Ophiocordyceps kimflemingae Ophio5|4911
Ophiocordyceps subramaniannii Hirsu2|11143

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05338
MDTADSPPSVDARSDDEEGGYDTVTVGSDRRGVKLLFAKSKVYVHPTPSARDNVAGYIALLQQKTPSDRPSSPSS
SSSVSPASSDLLLAWIPESALGDAAGLYVKADLSEAESPTSHPYLVPPPPTVTTMAGSVGGYAFAVPLSAIFSLL
VRPPSVGWWHGSIVINARNGEGAFPPLFFHDGECQSTMLQKKRLARDAFDPFGEDGRAFWGADEVLRWLRRYVRL
ERSGPEPNVYLMEPSDEDVESFGQNSAAAAAASTATDTEDAFVKFVKDTGWSIMNQFSKVTTLTRRAAQDLADNS
NVPPQVRRLLRNPEVQTLQNEFDSARIYLARWAMGIAEQSERDHRTRYWTARDVAELEDTDVGAFELVDVNSAKD
TRRAVTTTEWKTWFDDAGKLSVTVDEVKERIFHGGLADDGRNFLRDQSGMRAQLLALDQLVALMDPPLWEHLGKT
DSTNFFFMFRMVLVWYKREFVWGDVLTLWERLWTDWLSSEMHLFIALAILEKHRDVMMQHLKAFDEVLKYVNELA
NTMDLESTLLRAESLFRRFQRLVDAMDKRDNFPAPTSAAATAARDVQRRNTSVTPELRRLLGREPHVCVEES*
Coding >Ophcf2|05338
ATGGACACGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCCGACGACGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTTCTCTTCGCAAAGAGCAAAGTCTACGTCCATCCCACGCCGTCGGCA
CGCGACAATGTGGCAGGCTACATCGCCCTCCTACAGCAAAAGACACCCTCCGACCGTCCATCCTCACCATCCTCG
TCCTCGTCCGTCTCCCCCGCCTCATCTGACCTGCTCCTCGCATGGATCCCAGAGTCGGCGCTGGGTGATGCGGCG
GGATTATACGTCAAGGCCGATCTCAGCGAGGCGGAATCCCCAACCTCGCATCCGTATCTCGTCCCCCCGCCCCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGAGGATACGCCTTCGCCGTCCCGCTGAGTGCCATCTTCTCGCTGCTT
GTCCGACCGCCGAGCGTGGGGTGGTGGCATGGGTCTATCGTCATCAACGCGCGGAACGGGGAGGGAGCTTTCCCC
CCTTTGTTCTTTCATGACGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTCGCGCGCGATGCCTTTGAT
CCCTTTGGCGAGGATGGACGTGCGTTTTGGGGCGCGGACGAGGTTTTGCGCTGGTTACGTCGATACGTCCGTCTT
GAGCGCTCCGGACCGGAACCGAATGTGTATCTGATGGAGCCGAGCGACGAAGATGTCGAATCCTTTGGCCAAAAT
TCAGCCGCCGCCGCCGCCGCTTCAACCGCCACCGACACGGAAGATGCATTCGTCAAATTCGTCAAGGATACGGGC
TGGTCCATCATGAACCAGTTCAGCAAAGTCACGACCCTGACGCGACGTGCTGCTCAGGACCTAGCCGACAACTCC
AACGTCCCCCCGCAAGTGCGCCGCCTCCTCCGCAACCCAGAGGTGCAAACCCTGCAGAACGAATTCGACAGTGCG
CGCATCTACCTCGCCCGCTGGGCGATGGGCATCGCCGAACAAAGCGAGCGGGACCACCGCACTCGATACTGGACG
GCCCGTGACGTCGCCGAGCTGGAAGACACCGACGTCGGCGCCTTCGAACTCGTCGACGTCAACTCCGCCAAAGAC
ACGCGACGAGCGGTGACGACAACCGAGTGGAAAACCTGGTTCGACGATGCGGGAAAGCTTTCCGTTACCGTCGAC
GAGGTCAAGGAGCGCATCTTCCACGGCGGGCTGGCGGATGATGGCCGCAACTTCCTACGCGACCAGTCCGGAATG
CGCGCCCAGCTCCTCGCCCTCGACCAGCTCGTCGCCCTCATGGATCCGCCGCTATGGGAACACCTCGGCAAGACG
GATAGCACCAACTTCTTCTTCATGTTTCGCATGGTGCTCGTGTGGTATAAGCGAGAGTTTGTTTGGGGGGATGTG
CTGACGCTTTGGGAGAGGCTTTGGACGGATTGGCTGAGTTCGGAGATGCATCTTTTTATTGCCTTGGCTATTCTG
GAGAAGCATCGGGATGTCATGATGCAGCATCTAAAGGCGTTTGACGAGGTGCTCAAGTACGTCAACGAACTCGCC
AACACAATGGACCTCGAATCCACCCTCCTCCGCGCAGAGTCCCTCTTCCGCCGCTTCCAACGCCTCGTCGACGCC
ATGGACAAACGCGACAACTTCCCCGCTCCCACTTCCGCCGCCGCCACCGCTGCCAGAGACGTCCAGCGTAGGAAT
ACCAGTGTCACGCCCGAGTTGCGGAGGTTGCTTGGGAGGGAGCCTCATGTCTGTGTTGAGGAGTCGTAA
Transcript >Ophcf2|05338
ATGGACACGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCCGACGACGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTTCTCTTCGCAAAGAGCAAAGTCTACGTCCATCCCACGCCGTCGGCA
CGCGACAATGTGGCAGGCTACATCGCCCTCCTACAGCAAAAGACACCCTCCGACCGTCCATCCTCACCATCCTCG
TCCTCGTCCGTCTCCCCCGCCTCATCTGACCTGCTCCTCGCATGGATCCCAGAGTCGGCGCTGGGTGATGCGGCG
GGATTATACGTCAAGGCCGATCTCAGCGAGGCGGAATCCCCAACCTCGCATCCGTATCTCGTCCCCCCGCCCCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGAGGATACGCCTTCGCCGTCCCGCTGAGTGCCATCTTCTCGCTGCTT
GTCCGACCGCCGAGCGTGGGGTGGTGGCATGGGTCTATCGTCATCAACGCGCGGAACGGGGAGGGAGCTTTCCCC
CCTTTGTTCTTTCATGACGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTCGCGCGCGATGCCTTTGAT
CCCTTTGGCGAGGATGGACGTGCGTTTTGGGGCGCGGACGAGGTTTTGCGCTGGTTACGTCGATACGTCCGTCTT
GAGCGCTCCGGACCGGAACCGAATGTGTATCTGATGGAGCCGAGCGACGAAGATGTCGAATCCTTTGGCCAAAAT
TCAGCCGCCGCCGCCGCCGCTTCAACCGCCACCGACACGGAAGATGCATTCGTCAAATTCGTCAAGGATACGGGC
TGGTCCATCATGAACCAGTTCAGCAAAGTCACGACCCTGACGCGACGTGCTGCTCAGGACCTAGCCGACAACTCC
AACGTCCCCCCGCAAGTGCGCCGCCTCCTCCGCAACCCAGAGGTGCAAACCCTGCAGAACGAATTCGACAGTGCG
CGCATCTACCTCGCCCGCTGGGCGATGGGCATCGCCGAACAAAGCGAGCGGGACCACCGCACTCGATACTGGACG
GCCCGTGACGTCGCCGAGCTGGAAGACACCGACGTCGGCGCCTTCGAACTCGTCGACGTCAACTCCGCCAAAGAC
ACGCGACGAGCGGTGACGACAACCGAGTGGAAAACCTGGTTCGACGATGCGGGAAAGCTTTCCGTTACCGTCGAC
GAGGTCAAGGAGCGCATCTTCCACGGCGGGCTGGCGGATGATGGCCGCAACTTCCTACGCGACCAGTCCGGAATG
CGCGCCCAGCTCCTCGCCCTCGACCAGCTCGTCGCCCTCATGGATCCGCCGCTATGGGAACACCTCGGCAAGACG
GATAGCACCAACTTCTTCTTCATGTTTCGCATGGTGCTCGTGTGGTATAAGCGAGAGTTTGTTTGGGGGGATGTG
CTGACGCTTTGGGAGAGGCTTTGGACGGATTGGCTGAGTTCGGAGATGCATCTTTTTATTGCCTTGGCTATTCTG
GAGAAGCATCGGGATGTCATGATGCAGCATCTAAAGGCGTTTGACGAGGTGCTCAAGTACGTCAACGAACTCGCC
AACACAATGGACCTCGAATCCACCCTCCTCCGCGCAGAGTCCCTCTTCCGCCGCTTCCAACGCCTCGTCGACGCC
ATGGACAAACGCGACAACTTCCCCGCTCCCACTTCCGCCGCCGCCACCGCTGCCAGAGACGTCCAGCGTAGGAAT
ACCAGTGTCACGCCCGAGTTGCGGAGGTTGCTTGGGAGGGAGCCTCATGTCTGTGTTGAGGAGTCGTAA
Gene >Ophcf2|05338
ATGGACACGGCAGACTCACCGCCCAGCGTCGACGCTCGCTCCGACGACGAGGAAGGAGGCTACGATACCGTCACC
GTCGGCTCCGACCGTCGAGGCGTAAAGCTTCTCTTCGCAAAGAGCAAAGTCTACGTCCATCCCACGCCGTCGGCA
CGCGACAATGTGGCAGGCTACATCGCCCTCCTACAGCAAAAGACACCCTCCGACCGTCCATCCTCACCATCCTCG
TCCTCGTCCGTCTCCCCCGCCTCATCTGACCTGCTCCTCGCATGGATCCCAGAGTCGGCGCTGGGTGATGCGGCG
GGATTATACGTCAAGGCCGATCTCAGCGAGGCGGAATCCCCAACCTCGCATCCGTATCTCGTCCCCCCGCCCCCG
ACGGTGACGACGATGGCGGGTTCGGTGGGAGGATACGCCTTCGCCGTCCCGCTGAGTGCCATCTTCTCGCTGCTT
GTCCGACCGCCGAGCGTGGGGTGGTGGCATGGGTCTATCGTCATCAACGCGCGGAACGGGGAGGGAGCTTTCCCC
CCTTTGTTCTTTCATGACGGGGAGTGTCAGAGTACGATGCTGCAGAAGAAGAGGCTCGCGCGCGATGCCTTTGAT
CCCTTTGGCGAGGATGGACGTGCGTTTTGGGGCGCGGACGAGGTTTTGCGCTGGTTACGTCGATACGTCCGTCTT
GAGCGCTCCGGACCGGAACCGAATGTGTATCTGATGGAGCCGAGCGACGAAGATGTCGAATCCTTTGGCCAAAAT
TCAGCCGCCGCCGCCGCCGCTTCAACCGCCACCGACACGGAAGATGCATTCGTCAAATTCGTCAAGGATACGGGC
TGGTCCATCATGAACCAGTTCAGCAAAGTCACGACCCTGACGCGACGTGCTGCTCAGGACCTAGCCGACAACTCC
AACGTCCCCCCGCAAGTGCGCCGCCTCCTCCGCAACCCAGAGGTGCAAACCCTGCAGAACGAATTCGACAGTGCG
CGCATCTACCTCGCCCGCTGGGCGATGGGCATCGCCGAACAAAGCGAGCGGGACCACCGCACTCGATACTGGACG
GCCCGTGACGTCGCCGAGCTGGAAGACACCGACGTCGGCGCCTTCGAACTCGTCGACGTCAACTCCGCCAAAGAC
ACGCGACGAGCGGTGACGACAACCGAGTGGAAAACCTGGTTCGACGATGCGGGAAAGCTTTCCGTTACCGTCGAC
GAGGTCAAGGAGCGCATCTTCCACGGCGGGCTGGCGGATGATGGCGTCAGGAAGGAGGCCTGGCTGTTCCTCCTC
GGTGTCTATGACTGGCATGGGACGGCGGATGAGAGGAGGGCGCAGGAGGCGTCGTTGAGGGATCGCTATTATCAG
TTGAAGCAGGCTTGGTGGGATCATCGGATTGGGGGGGGAGGGAGGGGGAGGGAGGAGTGGTGGCGGGAGCAGAGG
GGCGAATTGGTGAGTTTGCGCTTGTTCCTTGTTTGTTTGTCTTTCTTGTCTTGCTCTTCTGTTGCTTCTGGCCTT
GTGTCTTTTTTTCGTCCTTTCTCTCATGGTCGTCTCTCTTCTCTTCTTTCTCTCGCTGTGCTTTATCCTTTCTCT
GCTCGTCTTCTTCCTCCTTCTCTCCATCTATCTCTTTTCACTTTCACTCAACTCTAGTTGTCCTTCTTCCCCCTT
CTCTCCTTATATCTCTTTCTCTTTCTCTTTCTCTCTTAACTCTAGTTGTCCTTCTTCCTCCTTCACTCCATCTAT
CTCTTTCACTTTCACTCAACTCTAGTTGTCCTTCTTCCCCCTTCTCTCCATCCATCTCTTTCAACTTTCACTTTC
TCTCCTCTCAACTCCAGTTGTCCTTCTTTCCCCTTCTCTCCAACCTCCTCTACCTCTTCCTCTCCTCTCTTCAGC
TGTCTTCTCTTCCCCTTTCCCCTTTCTTCCTACCAGTCCACCGCTAACTCTCCCCCCCTCTCTCCAGAAAAGACG
TCCACCGAACAGACCGCAACATCCCCCCTTCACCGGCGAAGACACCCCCACCCCGACCCAACCTCCCCTTCGCCG
ACGTCGGCACAAACGCCCACCTCGAACAAATGAAAGAAATGCTCCTAACCTACAACGAACACAACCGCTCCCTGG
GCTACGTCCAAGGCATGTCCGACCTCCTCTCCCCCCTCTACGCAACCCTCCAAGACGACGCCCTCGCCTTCTGGG
CCTTTGCAAACTTCATGCGGCGCATGCAGCGCAACTTCCTACGCGACCAGTCCGGAATGCGCGCCCAGCTCCTCG
CCCTCGACCAGCTCGTCGCCCTCATGGATCCGCCGCTATGGGAACACCTCGGCAAGACGGATAGCACCAACTTCT
TCTTCATGTTTCGCATGGTGCTCGTGTGGTATAAGCGAGAGTTTGTTTGGGGGGATGTGCTGACGCTTTGGGAGA
GGCTTTGGACGGATTGGCTGAGTTCGGAGATGCATCTTTTTATTGCCTTGGCTATTCTGGAGAAGCATCGGGATG
TCATGATGCAGCATCTAAAGGCGTTTGACGAGGTGCTCAAGTACGGTGAGTCTACGTTTTCTCAGTCTGACATCT
TCAGATGATGTTTTCCCATTCTATGTCCATCTTTCCCCCATTCTCCTATACACCCCCTTCTCCAACTCCCTATTC
AACCCCTATTCTTTTCTACACCCCCCTCCTCGAGTCCCTACTCTACTCTCTACCCCCCTCTTTAATCCCTTCCTC
CCTCCACCTCCCTCCTCTCCAACCCAACTAACAAGGCCCAGTCAACGAACTCGCCAACACAATGGACCTCGAATC
CACCCTCCTCCGCGCAGAGTCCCTCTTCCGCCGCTTCCAACGCCTCGTCGACGCCATGGACAAACGCGACAACTT
CCCCGCTCCCACTTCCGCCGCCGCCACCGCTGCCAGAGACGTCCAGCGTAGGAATACCAGTGTCACGCCCGAGTT
GCGGAGGTTGCTTGGGAGGGAGCCTCATGTCTGTGTTGAGGAGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail