Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05333
Gene name
Locationscaffold_05:3327132..3333455
Strand+
Gene length (bp)6323
Transcript length (bp)5304
Coding sequence length (bp)5304
Protein length (aa) 1768

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 7.8E-142 387 834
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 1.1E-23 277 352
PF00924 MS_channel Mechanosensitive ion channel 3.1E-20 1400 1578
PF17137 DUF5110 Domain of unknown function (DUF5110) 3.2E-06 856 894

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016020 membrane Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0051179 localization No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 1053 1075 22
3 1082 1104 22
4 1108 1130 22
5 1143 1160 17
6 1188 1210 22
7 1400 1422 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05333
MGHSPGLWSRSWTAVFCLVIALLCVMQPAASVKEHDFKKCDQSGFCRRNRAYADNAAAEHATWTSPYRVDANSAV
LKDGQLHAMVIKTLNAAGETARFPMTASFLKSGAARLTVDEERRRKGDIELRHNSRARKERYNEAEKWAIVGGLE
LDKAAKVAFQDKTQINIQYGPGSTLEAVIKFEPFEMEFRRGGESHVRLNGRGLLNMEHWRPKVEKKQAEGEAKTE
GQEAAEGDNKAEDQTGGEDESTWWDESFGGNTDTKPRGPESVALDVSFLGYDHVFGIPEHAGPLSLKQTRGGEGN
YGEPYRLYNLDVFEYILDSPMTLYGAIPLMQAHRKGSTVGVFWLNAAETWIDIVKGHDSANPKNLGLGPKTNTHT
HWISESGVLDVFVLMGPTPHDLTRTYGELTGYTAMPQEFSIGYHQCRWNYMSDDDVRDVDRKMDKAMIPYDVIWL
DIEYTDDRKYFTWEPHSFTDPIGTGQQLAERGRKLVVIIDPHIKKLDGYPINKQMTSQDLAVHNKDGETYEGWCW
PGSSNWIDCFNPKANEWWKSLFKYDTFKGTRENTFIWNDMNEPSVFNGPETTMPKDNLHHGGWEHRDVHNLNGLT
FQNATYEALISRKKGEVRRPFVLTRAFYSGSQRLGAMWTGDNQAAWDHLAASIPMVLNQGISGFPFAGADVGGFF
GNPERELLARWYQAGAFYPFFRGHAHIDSRRREPYLLGEPYTAIVTAALRLRYSLLPAWYTAFFHAHRDGSPIVR
PMFWTHPDEEDGFAIDDQMFLGSTGLLVKPVTEQGKETADLLIPDDERYYDYSTYALMSTQRGKRLTVRAALNQI
PLLMRGGHVFPRRDIPRRSSGLMRFDDYTLVVTVSKSGSAEGELYVDDGDTFDFQKGQYIHRRFRLSGNELSSVD
ADGREDKAVEAGPWLNKMEGVSVDKIIVVGAPAKWKSREVSIESEGKKWMVKAEYHEASKGTGAFLMLGRVGAKI
GKDWRVVLGQRAHHVREKDDLEIFRVERCVSNAQREAGAKAESEMEDDYDEDENASDKQGGKHALDKLRSMVHKL
PRFVRYLIYLIPGAVLLLIPVLLGTVNTDPDSRLLGGVGGVELMWFGIWLEIMWCSLWLSRLVTSALPYVLAGLA
WIMASHVPKQWKELGRRLEVPSAIFLWFLAILISFKPTNDGHHARSPGEDDAGLEWVNTVNKVIIALFTLATLNF
LEKIIIQWIATSFHRRTYSTRIQNNKADIRQLAQLYEHAKVKLNHNHSFLQNTGPGVGGSTTTTLQTLHENARQV
LGKFGQVAGKVGNDLIGRKVNIDSTLKIVEELLRSTMASYTLARFIYRSLVRSDRETVHPEDMKAVFKTKEEVDA
AFNVFDKDLNGDISLEEFQVVCNEIHLEKKAIAASLKDLDSVIHKLDRVFLSISIIIAAVVFIVTMSGSATAGLA
SVGSTVLGLAWMLQATAQEFLQSIIFVFIKHPFDVGDRVTIYGSTGAKMKGDEYYVTEISLLYTEFKKMQGHIVQ
APNSLLNTLFILNYRRSNGTSDPIRLEMRFGTPAHQIEELKDRLLAFCLRNKRDFYPKVVTEMLKLEDVRSCSMN
IVVKHKGNFQSETVRQTRHNKLVTEIMHLMTTIGIQGPYRTDPGGSYEFPMYWTGVHPPPSTAPAPAPAPDTTQG
PTPGDGMPTPSAPTSSLPQPPPSFRRRRRTLIDDDGTGDAENVYEHRRDMVASSRKMSIRRKERGFRLETEAQAA
VESPPEMLSRSTSRVSGTPPRPGFFQRSATVFIRGSASDPPV*
Coding >Ophcf2|05333
ATGGGGCACTCGCCTGGGCTGTGGTCCCGGAGCTGGACTGCCGTCTTTTGCCTCGTCATAGCATTGCTCTGCGTC
ATGCAGCCAGCAGCCTCGGTCAAGGAGCATGACTTCAAGAAATGCGATCAGTCGGGTTTCTGTCGGCGGAACCGC
GCGTACGCCGACAACGCCGCTGCCGAGCACGCGACTTGGACCTCGCCCTATCGAGTCGATGCGAATTCAGCGGTC
CTGAAAGACGGCCAGCTTCACGCCATGGTGATCAAGACGCTCAACGCGGCTGGAGAGACGGCGCGCTTCCCCATG
ACGGCATCCTTCCTCAAGAGCGGTGCCGCCCGCCTCACCGTCGACGAAGAAAGGCGGCGCAAGGGCGACATTGAG
CTGAGGCACAATAGCCGTGCCCGTAAGGAACGATACAACGAAGCCGAGAAGTGGGCCATAGTCGGTGGCCTGGAG
CTGGATAAAGCGGCCAAGGTGGCCTTCCAAGACAAGACGCAGATCAACATACAGTACGGGCCTGGATCGACCCTC
GAGGCTGTCATCAAGTTTGAGCCCTTTGAGATGGAGTTTCGGCGCGGCGGAGAAAGTCACGTTCGACTCAACGGC
CGTGGCCTGCTCAACATGGAGCACTGGCGACCCAAGGTGGAAAAGAAGCAAGCCGAGGGTGAAGCAAAGACCGAG
GGCCAGGAAGCAGCCGAGGGCGACAATAAAGCCGAAGACCAGACGGGTGGCGAGGACGAGAGCACCTGGTGGGAC
GAGTCGTTTGGCGGCAACACCGACACCAAGCCTCGAGGCCCGGAGAGCGTCGCACTGGATGTCTCGTTCCTCGGA
TACGACCACGTCTTTGGCATACCCGAGCACGCCGGTCCCCTGTCTCTCAAGCAGACTCGCGGAGGCGAGGGCAAT
TACGGCGAGCCCTACCGGCTGTACAATCTCGATGTGTTCGAGTACATCCTCGACAGCCCCATGACGCTCTACGGC
GCCATTCCCTTGATGCAGGCCCACCGAAAGGGCTCGACCGTAGGCGTCTTCTGGCTCAACGCGGCCGAGACGTGG
ATCGACATCGTCAAGGGGCACGACAGCGCCAACCCTAAGAACCTCGGACTGGGGCCCAAGACCAACACGCACACG
CACTGGATCTCGGAGAGCGGCGTTCTCGACGTCTTCGTACTGATGGGCCCGACGCCTCACGACCTGACGCGCACC
TACGGCGAGCTCACGGGCTATACGGCCATGCCGCAGGAGTTCTCCATCGGCTACCATCAGTGTCGCTGGAACTAC
ATGTCGGACGATGACGTACGCGACGTGGACCGCAAGATGGACAAGGCCATGATCCCATACGACGTCATCTGGCTC
GATATTGAGTACACGGACGACAGGAAGTACTTTACTTGGGAGCCGCACTCGTTCACGGACCCGATTGGCACCGGC
CAGCAGCTCGCGGAGCGCGGCCGGAAGCTGGTTGTCATCATCGACCCTCACATCAAGAAGCTGGACGGATACCCG
ATCAACAAGCAGATGACGTCGCAGGACCTGGCGGTACACAACAAGGACGGCGAGACGTACGAAGGTTGGTGCTGG
CCCGGATCCTCCAACTGGATCGACTGCTTCAACCCCAAGGCCAACGAGTGGTGGAAGTCGCTCTTCAAGTACGAC
ACCTTCAAGGGAACGCGTGAAAATACCTTTATCTGGAACGACATGAACGAGCCGTCCGTCTTCAACGGGCCGGAG
ACGACGATGCCCAAGGACAATCTTCATCACGGGGGCTGGGAGCATCGTGACGTGCACAACCTCAATGGCCTCACC
TTTCAGAACGCCACGTACGAGGCCCTCATTTCGCGCAAAAAGGGGGAAGTCCGGCGGCCGTTTGTTCTGACGCGG
GCCTTTTACTCCGGCTCGCAGCGGCTGGGCGCCATGTGGACGGGCGACAATCAGGCCGCCTGGGATCATCTGGCG
GCCTCGATCCCCATGGTGCTGAACCAAGGCATCTCTGGCTTCCCCTTTGCTGGTGCCGACGTGGGAGGCTTCTTC
GGCAACCCGGAAAGGGAGCTGCTGGCTCGCTGGTATCAGGCTGGCGCTTTTTACCCATTCTTCCGCGGCCACGCC
CATATCGACTCGCGAAGACGCGAGCCCTACCTGCTGGGAGAGCCGTACACGGCCATAGTGACGGCGGCTCTACGA
CTACGCTACTCGCTGCTACCGGCCTGGTATACGGCCTTTTTCCACGCGCACCGGGACGGGAGCCCGATCGTGAGG
CCCATGTTCTGGACACATCCTGACGAAGAAGACGGCTTCGCCATCGACGACCAGATGTTCCTCGGATCGACGGGT
CTGCTGGTCAAGCCCGTGACGGAGCAGGGCAAGGAGACGGCTGACTTGTTGATCCCGGACGACGAGAGATATTAC
GACTACTCGACTTATGCCTTGATGAGCACGCAGAGGGGAAAGCGGCTGACGGTGAGGGCTGCCCTGAACCAGATC
CCGCTGCTCATGCGCGGCGGTCACGTGTTTCCGCGACGGGACATCCCGCGGAGGTCGAGCGGGTTGATGCGGTTT
GACGACTACACGCTTGTCGTGACTGTGTCCAAGAGCGGCTCGGCAGAGGGCGAGCTCTACGTGGACGACGGCGAC
ACGTTTGACTTTCAAAAGGGGCAGTATATCCATCGCCGCTTCCGGCTTTCCGGTAATGAGCTGTCGTCGGTCGAC
GCCGACGGCCGCGAAGACAAGGCCGTCGAGGCCGGGCCTTGGCTCAACAAGATGGAGGGCGTGTCTGTCGACAAG
ATCATTGTGGTGGGCGCTCCGGCCAAGTGGAAGAGTAGGGAGGTTAGCATCGAGTCTGAGGGAAAGAAGTGGATG
GTCAAGGCAGAGTATCACGAGGCCAGCAAGGGGACGGGAGCGTTTCTGATGCTGGGGAGGGTGGGAGCGAAGATT
GGCAAGGACTGGAGGGTTGTGCTGGGTCAACGCGCCCACCACGTCCGCGAAAAAGATGACCTCGAAATCTTCCGA
GTCGAACGGTGCGTAAGCAACGCCCAACGCGAAGCCGGCGCAAAAGCCGAGTCGGAAATGGAAGACGACTACGAC
GAAGATGAAAACGCGTCGGATAAACAGGGTGGGAAACATGCGCTCGATAAGCTGCGATCCATGGTGCATAAACTC
CCTCGCTTCGTCCGCTACCTCATCTATCTCATTCCCGGGGCCGTCTTGCTGCTCATTCCCGTCTTGCTGGGGACG
GTGAATACCGATCCGGATAGTCGGTTGCTTGGCGGGGTCGGGGGTGTCGAACTGATGTGGTTTGGGATCTGGTTG
GAGATTATGTGGTGTTCGCTTTGGCTTTCGAGGTTGGTCACCAGTGCTTTGCCGTATGTGCTTGCTGGGTTGGCT
TGGATTATGGCTTCTCATGTTCCGAAGCAGTGGAAGGAACTTGGGAGGAGGCTGGAGGTTCCCAGTGCCATCTTC
TTATGGTTTCTCGCGATACTCATCTCCTTTAAGCCAACTAACGATGGCCATCACGCTCGATCACCGGGAGAAGAC
GACGCCGGTCTGGAATGGGTCAACACGGTCAACAAGGTCATCATCGCCCTCTTCACACTGGCAACTCTCAACTTT
TTAGAAAAGATCATCATCCAGTGGATAGCAACCTCGTTCCACCGCCGAACCTACTCAACCCGGATCCAGAACAAC
AAAGCCGACATCCGACAACTAGCCCAACTCTACGAACACGCAAAGGTCAAGCTGAACCACAACCACAGCTTCTTG
CAGAACACCGGCCCGGGCGTGGGCGGCTCGACGACGACGACGCTGCAGACGCTGCACGAGAACGCTCGGCAGGTG
CTCGGCAAGTTCGGACAGGTTGCTGGGAAAGTAGGCAACGATCTTATCGGGAGGAAAGTTAATATCGATTCGACG
CTCAAGATCGTGGAGGAGTTGTTGAGGAGTACCATGGCTTCTTATACGCTTGCCAGGTTTATCTATCGGAGTTTG
GTGAGGTCTGATCGCGAGACGGTTCATCCCGAGGATATGAAGGCTGTCTTTAAGACGAAAGAGGAGGTCGACGCT
GCCTTCAACGTCTTTGACAAGGATCTCAACGGCGACATCTCACTGGAAGAGTTTCAAGTCGTCTGCAACGAGATC
CACCTCGAGAAGAAAGCCATCGCCGCCTCTCTCAAAGATCTCGACTCAGTAATCCACAAACTCGACCGCGTCTTT
CTCTCCATCAGCATCATCATCGCCGCCGTCGTCTTCATCGTCACAATGTCCGGTTCCGCAACCGCAGGTCTCGCC
TCCGTCGGGAGCACCGTCCTCGGCCTCGCCTGGATGCTACAGGCCACGGCGCAGGAGTTCCTTCAGTCCATCATC
TTCGTCTTCATCAAGCATCCGTTTGACGTGGGTGATCGCGTCACCATCTACGGATCGACGGGCGCCAAGATGAAG
GGGGATGAGTATTACGTTACCGAGATTTCACTTCTTTATACCGAGTTTAAGAAGATGCAGGGGCACATCGTGCAG
GCGCCTAACTCGTTGCTCAACACGCTGTTCATTCTCAACTATCGGCGTTCCAACGGGACTTCGGATCCGATCAGA
CTGGAGATGCGGTTTGGGACGCCGGCTCATCAGATTGAAGAGCTCAAGGACAGGTTACTGGCATTTTGTCTGCGG
AACAAGAGGGATTTCTACCCCAAGGTCGTGACGGAGATGCTTAAACTCGAAGACGTCCGCTCATGCTCCATGAAC
ATCGTCGTCAAGCACAAAGGCAACTTCCAAAGCGAGACGGTCCGCCAGACCCGTCACAACAAACTGGTGACAGAG
ATCATGCACCTGATGACGACCATCGGCATACAGGGTCCCTACCGCACCGACCCGGGCGGAAGCTACGAGTTCCCC
ATGTACTGGACCGGCGTCCATCCGCCTCCGTCTACGGCTCCGGCTCCGGCTCCGGCTCCGGATACGACTCAGGGT
CCGACGCCGGGTGACGGCATGCCGACGCCAAGCGCGCCAACCAGCAGTCTTCCTCAGCCGCCGCCTAGCTTCAGG
AGGCGCAGGCGGACGCTCATCGATGACGATGGGACGGGTGATGCCGAGAACGTGTATGAGCATCGGCGTGACATG
GTGGCTTCAAGTCGTAAGATGTCTATCCGCAGGAAGGAGCGCGGGTTTCGGCTTGAGACGGAGGCTCAGGCTGCG
GTCGAGTCGCCGCCGGAGATGCTGTCGAGATCGACGTCGAGGGTTTCGGGGACGCCTCCGCGGCCGGGCTTCTTT
CAGCGGTCGGCGACTGTGTTTATCAGGGGGAGCGCGTCTGATCCACCGGTGTGA
Transcript >Ophcf2|05333
ATGGGGCACTCGCCTGGGCTGTGGTCCCGGAGCTGGACTGCCGTCTTTTGCCTCGTCATAGCATTGCTCTGCGTC
ATGCAGCCAGCAGCCTCGGTCAAGGAGCATGACTTCAAGAAATGCGATCAGTCGGGTTTCTGTCGGCGGAACCGC
GCGTACGCCGACAACGCCGCTGCCGAGCACGCGACTTGGACCTCGCCCTATCGAGTCGATGCGAATTCAGCGGTC
CTGAAAGACGGCCAGCTTCACGCCATGGTGATCAAGACGCTCAACGCGGCTGGAGAGACGGCGCGCTTCCCCATG
ACGGCATCCTTCCTCAAGAGCGGTGCCGCCCGCCTCACCGTCGACGAAGAAAGGCGGCGCAAGGGCGACATTGAG
CTGAGGCACAATAGCCGTGCCCGTAAGGAACGATACAACGAAGCCGAGAAGTGGGCCATAGTCGGTGGCCTGGAG
CTGGATAAAGCGGCCAAGGTGGCCTTCCAAGACAAGACGCAGATCAACATACAGTACGGGCCTGGATCGACCCTC
GAGGCTGTCATCAAGTTTGAGCCCTTTGAGATGGAGTTTCGGCGCGGCGGAGAAAGTCACGTTCGACTCAACGGC
CGTGGCCTGCTCAACATGGAGCACTGGCGACCCAAGGTGGAAAAGAAGCAAGCCGAGGGTGAAGCAAAGACCGAG
GGCCAGGAAGCAGCCGAGGGCGACAATAAAGCCGAAGACCAGACGGGTGGCGAGGACGAGAGCACCTGGTGGGAC
GAGTCGTTTGGCGGCAACACCGACACCAAGCCTCGAGGCCCGGAGAGCGTCGCACTGGATGTCTCGTTCCTCGGA
TACGACCACGTCTTTGGCATACCCGAGCACGCCGGTCCCCTGTCTCTCAAGCAGACTCGCGGAGGCGAGGGCAAT
TACGGCGAGCCCTACCGGCTGTACAATCTCGATGTGTTCGAGTACATCCTCGACAGCCCCATGACGCTCTACGGC
GCCATTCCCTTGATGCAGGCCCACCGAAAGGGCTCGACCGTAGGCGTCTTCTGGCTCAACGCGGCCGAGACGTGG
ATCGACATCGTCAAGGGGCACGACAGCGCCAACCCTAAGAACCTCGGACTGGGGCCCAAGACCAACACGCACACG
CACTGGATCTCGGAGAGCGGCGTTCTCGACGTCTTCGTACTGATGGGCCCGACGCCTCACGACCTGACGCGCACC
TACGGCGAGCTCACGGGCTATACGGCCATGCCGCAGGAGTTCTCCATCGGCTACCATCAGTGTCGCTGGAACTAC
ATGTCGGACGATGACGTACGCGACGTGGACCGCAAGATGGACAAGGCCATGATCCCATACGACGTCATCTGGCTC
GATATTGAGTACACGGACGACAGGAAGTACTTTACTTGGGAGCCGCACTCGTTCACGGACCCGATTGGCACCGGC
CAGCAGCTCGCGGAGCGCGGCCGGAAGCTGGTTGTCATCATCGACCCTCACATCAAGAAGCTGGACGGATACCCG
ATCAACAAGCAGATGACGTCGCAGGACCTGGCGGTACACAACAAGGACGGCGAGACGTACGAAGGTTGGTGCTGG
CCCGGATCCTCCAACTGGATCGACTGCTTCAACCCCAAGGCCAACGAGTGGTGGAAGTCGCTCTTCAAGTACGAC
ACCTTCAAGGGAACGCGTGAAAATACCTTTATCTGGAACGACATGAACGAGCCGTCCGTCTTCAACGGGCCGGAG
ACGACGATGCCCAAGGACAATCTTCATCACGGGGGCTGGGAGCATCGTGACGTGCACAACCTCAATGGCCTCACC
TTTCAGAACGCCACGTACGAGGCCCTCATTTCGCGCAAAAAGGGGGAAGTCCGGCGGCCGTTTGTTCTGACGCGG
GCCTTTTACTCCGGCTCGCAGCGGCTGGGCGCCATGTGGACGGGCGACAATCAGGCCGCCTGGGATCATCTGGCG
GCCTCGATCCCCATGGTGCTGAACCAAGGCATCTCTGGCTTCCCCTTTGCTGGTGCCGACGTGGGAGGCTTCTTC
GGCAACCCGGAAAGGGAGCTGCTGGCTCGCTGGTATCAGGCTGGCGCTTTTTACCCATTCTTCCGCGGCCACGCC
CATATCGACTCGCGAAGACGCGAGCCCTACCTGCTGGGAGAGCCGTACACGGCCATAGTGACGGCGGCTCTACGA
CTACGCTACTCGCTGCTACCGGCCTGGTATACGGCCTTTTTCCACGCGCACCGGGACGGGAGCCCGATCGTGAGG
CCCATGTTCTGGACACATCCTGACGAAGAAGACGGCTTCGCCATCGACGACCAGATGTTCCTCGGATCGACGGGT
CTGCTGGTCAAGCCCGTGACGGAGCAGGGCAAGGAGACGGCTGACTTGTTGATCCCGGACGACGAGAGATATTAC
GACTACTCGACTTATGCCTTGATGAGCACGCAGAGGGGAAAGCGGCTGACGGTGAGGGCTGCCCTGAACCAGATC
CCGCTGCTCATGCGCGGCGGTCACGTGTTTCCGCGACGGGACATCCCGCGGAGGTCGAGCGGGTTGATGCGGTTT
GACGACTACACGCTTGTCGTGACTGTGTCCAAGAGCGGCTCGGCAGAGGGCGAGCTCTACGTGGACGACGGCGAC
ACGTTTGACTTTCAAAAGGGGCAGTATATCCATCGCCGCTTCCGGCTTTCCGGTAATGAGCTGTCGTCGGTCGAC
GCCGACGGCCGCGAAGACAAGGCCGTCGAGGCCGGGCCTTGGCTCAACAAGATGGAGGGCGTGTCTGTCGACAAG
ATCATTGTGGTGGGCGCTCCGGCCAAGTGGAAGAGTAGGGAGGTTAGCATCGAGTCTGAGGGAAAGAAGTGGATG
GTCAAGGCAGAGTATCACGAGGCCAGCAAGGGGACGGGAGCGTTTCTGATGCTGGGGAGGGTGGGAGCGAAGATT
GGCAAGGACTGGAGGGTTGTGCTGGGTCAACGCGCCCACCACGTCCGCGAAAAAGATGACCTCGAAATCTTCCGA
GTCGAACGGTGCGTAAGCAACGCCCAACGCGAAGCCGGCGCAAAAGCCGAGTCGGAAATGGAAGACGACTACGAC
GAAGATGAAAACGCGTCGGATAAACAGGGTGGGAAACATGCGCTCGATAAGCTGCGATCCATGGTGCATAAACTC
CCTCGCTTCGTCCGCTACCTCATCTATCTCATTCCCGGGGCCGTCTTGCTGCTCATTCCCGTCTTGCTGGGGACG
GTGAATACCGATCCGGATAGTCGGTTGCTTGGCGGGGTCGGGGGTGTCGAACTGATGTGGTTTGGGATCTGGTTG
GAGATTATGTGGTGTTCGCTTTGGCTTTCGAGGTTGGTCACCAGTGCTTTGCCGTATGTGCTTGCTGGGTTGGCT
TGGATTATGGCTTCTCATGTTCCGAAGCAGTGGAAGGAACTTGGGAGGAGGCTGGAGGTTCCCAGTGCCATCTTC
TTATGGTTTCTCGCGATACTCATCTCCTTTAAGCCAACTAACGATGGCCATCACGCTCGATCACCGGGAGAAGAC
GACGCCGGTCTGGAATGGGTCAACACGGTCAACAAGGTCATCATCGCCCTCTTCACACTGGCAACTCTCAACTTT
TTAGAAAAGATCATCATCCAGTGGATAGCAACCTCGTTCCACCGCCGAACCTACTCAACCCGGATCCAGAACAAC
AAAGCCGACATCCGACAACTAGCCCAACTCTACGAACACGCAAAGGTCAAGCTGAACCACAACCACAGCTTCTTG
CAGAACACCGGCCCGGGCGTGGGCGGCTCGACGACGACGACGCTGCAGACGCTGCACGAGAACGCTCGGCAGGTG
CTCGGCAAGTTCGGACAGGTTGCTGGGAAAGTAGGCAACGATCTTATCGGGAGGAAAGTTAATATCGATTCGACG
CTCAAGATCGTGGAGGAGTTGTTGAGGAGTACCATGGCTTCTTATACGCTTGCCAGGTTTATCTATCGGAGTTTG
GTGAGGTCTGATCGCGAGACGGTTCATCCCGAGGATATGAAGGCTGTCTTTAAGACGAAAGAGGAGGTCGACGCT
GCCTTCAACGTCTTTGACAAGGATCTCAACGGCGACATCTCACTGGAAGAGTTTCAAGTCGTCTGCAACGAGATC
CACCTCGAGAAGAAAGCCATCGCCGCCTCTCTCAAAGATCTCGACTCAGTAATCCACAAACTCGACCGCGTCTTT
CTCTCCATCAGCATCATCATCGCCGCCGTCGTCTTCATCGTCACAATGTCCGGTTCCGCAACCGCAGGTCTCGCC
TCCGTCGGGAGCACCGTCCTCGGCCTCGCCTGGATGCTACAGGCCACGGCGCAGGAGTTCCTTCAGTCCATCATC
TTCGTCTTCATCAAGCATCCGTTTGACGTGGGTGATCGCGTCACCATCTACGGATCGACGGGCGCCAAGATGAAG
GGGGATGAGTATTACGTTACCGAGATTTCACTTCTTTATACCGAGTTTAAGAAGATGCAGGGGCACATCGTGCAG
GCGCCTAACTCGTTGCTCAACACGCTGTTCATTCTCAACTATCGGCGTTCCAACGGGACTTCGGATCCGATCAGA
CTGGAGATGCGGTTTGGGACGCCGGCTCATCAGATTGAAGAGCTCAAGGACAGGTTACTGGCATTTTGTCTGCGG
AACAAGAGGGATTTCTACCCCAAGGTCGTGACGGAGATGCTTAAACTCGAAGACGTCCGCTCATGCTCCATGAAC
ATCGTCGTCAAGCACAAAGGCAACTTCCAAAGCGAGACGGTCCGCCAGACCCGTCACAACAAACTGGTGACAGAG
ATCATGCACCTGATGACGACCATCGGCATACAGGGTCCCTACCGCACCGACCCGGGCGGAAGCTACGAGTTCCCC
ATGTACTGGACCGGCGTCCATCCGCCTCCGTCTACGGCTCCGGCTCCGGCTCCGGCTCCGGATACGACTCAGGGT
CCGACGCCGGGTGACGGCATGCCGACGCCAAGCGCGCCAACCAGCAGTCTTCCTCAGCCGCCGCCTAGCTTCAGG
AGGCGCAGGCGGACGCTCATCGATGACGATGGGACGGGTGATGCCGAGAACGTGTATGAGCATCGGCGTGACATG
GTGGCTTCAAGTCGTAAGATGTCTATCCGCAGGAAGGAGCGCGGGTTTCGGCTTGAGACGGAGGCTCAGGCTGCG
GTCGAGTCGCCGCCGGAGATGCTGTCGAGATCGACGTCGAGGGTTTCGGGGACGCCTCCGCGGCCGGGCTTCTTT
CAGCGGTCGGCGACTGTGTTTATCAGGGGGAGCGCGTCTGATCCACCGGTGTGA
Gene >Ophcf2|05333
ATGGGGCACTCGCCTGGGCTGTGGTCCCGGAGCTGGACTGCCGTCTTTTGCCTCGTCATAGCATTGCTCTGCGTC
ATGCAGCCAGCAGGTTTGATATAGCATACGAGTCCTCGGATGCTGGGCGCCACTGACGTCCTCGCTCTAGCCTCG
GTCAAGGAGCATGACTTCAAGAAATGCGATCAGTCGGGTTTCTGTCGGCGGAACCGCGCGTACGCCGACAACGCC
GCTGCCGAGCACGCGACTTGGACCTCGCCCTATCGAGTCGATGCGAATTCAGCGGTCCTGAAAGACGGCCAGCTT
CACGCCATGGTGATCAAGACGCTCAACGCGGCTGGAGAGACGGCGCGCTTCCCCATGACGGCATCCTTCCTCAAG
AGCGGTGCCGCCCGCCTCACCGTCGACGAAGAAAGGCGGCGCAAGGGCGACATTGAGCTGAGGCACAATAGCCGT
GCCCGTAAGGAACGATACAACGAAGCCGAGAAGTGGGCCATAGTCGGTGGCCTGGAGCTGGATAAAGCGGCCAAG
GTGGCCTTCCAAGACAAGACGCAGATCAACATACAGTACGGGCCTGGATCGACCCTCGAGGCTGTCATCAAGTTT
GAGCCCTTTGAGATGGAGTTTCGGCGCGGCGGAGAAAGTCACGTTCGACTCAACGGCCGTGGCCTGCTCAACATG
GAGCACTGGCGACCCAAGGTGGAAAAGAAGCAAGCCGAGGGTGAAGCAAAGACCGAGGGCCAGGAAGCAGCCGAG
GGCGACAATAAAGCCGAAGACCAGACGGGTGGCGAGGACGAGAGCACCTGGTGGGACGAGTCGTTTGGCGGCAAC
ACCGACACCAAGCCTCGAGGCCCGGAGAGCGTCGCACTGGATGTCTCGTTCCTCGGATACGACCACGTCTTTGGC
ATACCCGAGCACGCCGGTCCCCTGTCTCTCAAGCAGACTCGCGGAGGCGAGGGCAATTACGGCGAGCCCTACCGG
CTGTACAATCTCGATGTGTTCGAGTACATCCTCGACAGCCCCATGACGCTCTACGGCGCCATTCCCTTGATGCAG
GCCCACCGAAAGGGCTCGACCGTAGGCGTCTTCTGGCTCAACGCGGCCGAGACGTGGATCGACATCGTCAAGGGG
CACGACAGCGCCAACCCTAAGAACCTCGGACTGGGGCCCAAGACCAACACGCACACGCACTGGATCTCGGAGAGC
GGCGTTCTCGACGTCTTCGTACTGATGGGCCCGACGCCTCACGACCTGACGCGCACCTACGGCGAGCTCACGGGC
TATACGGCCATGCCGCAGGAGTTCTCCATCGGCTACCATCAGTGTCGCTGGAACTACATGTCGGACGATGACGTA
CGCGACGTGGACCGCAAGATGGACAAGGCCATGATCCCATACGACGTCATCTGGCTCGATATTGAGTACACGGAC
GACAGGAAGTACTTTACTTGGGAGCCGCACTCGTTCACGGACCCGATTGGCACCGGCCAGCAGCTCGCGGAGCGC
GGCCGGAAGCTGGTTGTCATCATCGACCCTCACATCAAGAAGCTGGACGGATACCCGATCAACAAGCAGATGACG
TCGCAGGACCTGGCGGTACACAACAAGGACGGCGAGACGTACGAAGGTTGGTGCTGGCCCGGATCCTCCAACTGG
ATCGACTGCTTCAACCCCAAGGCCAACGAGTGGTGGAAGTCGCTCTTCAAGTACGACACCTTCAAGGGAACGCGT
GAAAATACCTTTATCTGGAACGACATGAACGAGCCGTCCGTCTTCAACGGGCCGGAGACGACGATGCCCAAGGAC
AATCTTCATCACGGGGGCTGGGAGCATCGTGACGTGCACAACCTCAATGGCCTCACCTTTCAGAACGCCACGTAC
GAGGCCCTCATTTCGCGCAAAAAGGGGGAAGTCCGGCGGCCGTTTGTTCTGACGCGGGCCTTTTACTCCGGCTCG
CAGCGGCTGGGCGCCATGTGGACGGGCGACAATCAGGCCGCCTGGGATCATCTGGCGGCCTCGATCCCCATGGTG
CTGAACCAAGGCATCTCTGGCTTCCCCTTTGCTGGTGCCGACGTGGGAGGCTTCTTCGGCAACCCGGAAAGGGAG
CTGCTGGCTCGCTGGTATCAGGCTGGCGCTTTTTACCCATTCTTCCGCGGCCACGCCCATATCGACTCGCGAAGA
CGCGAGCCCTACCTGCTGGGAGAGCCGTACACGGCCATAGTGACGGCGGCTCTACGACTACGCTACTCGCTGCTA
CCGGCCTGGTATACGGCCTTTTTCCACGCGCACCGGGACGGGAGCCCGATCGTGAGGCCCATGTTCTGGACACAT
CCTGACGAAGAAGACGGCTTCGCCATCGACGACCAGATGTTCCTCGGATCGACGGGTCTGCTGGTCAAGCCCGTG
ACGGAGCAGGGCAAGGAGACGGCTGACTTGTTGATCCCGGACGACGAGAGATATTACGACTACTCGACTTATGCC
TTGATGAGCACGCAGAGGGGAAAGCGGCTGACGGTGAGGGCTGCCCTGAACCAGATCCCGCTGCTCATGCGCGGC
GGTCACGTGTTTCCGCGACGGGACATCCCGCGGAGGTCGAGCGGGTTGATGCGGTTTGACGACTACACGCTTGTC
GTGACTGTGTCCAAGAGCGGCTCGGCAGAGGGCGAGCTCTACGTGGACGACGGCGACACGTTTGACTTTCAAAAG
GGGCAGTATATCCATCGCCGCTTCCGGCTTTCCGGTAATGAGCTGTCGTCGGTCGACGCCGACGGCCGCGAAGAC
AAGGCCGTCGAGGCCGGGCCTTGGCTCAACAAGATGGAGGGCGTGTCTGTCGACAAGATCATTGTGGTGGGCGCT
CCGGCCAAGTGGAAGAGTAGGGAGGTTAGCATCGAGTCTGAGGGAAAGAAGTGGATGGTCAAGGCAGAGTATCAC
GAGGCCAGCAAGGGGACGGGAGCGTTTCTGATGCTGGGGAGGGTGGGAGCGAAGATTGGCAAGGACTGGAGGGTT
GTGCTGGGTAAGTGATGGGGATGAAGCATTGGTCAGGTAAAGGGGACGCTGGTTTGATATGCATTAGAGGCTCAC
GCTCATGAGGGATGGAGATTGGTAGACAAGGCAATGTGATGCATGCCATTACCCTTTAGTCTTGACCTTAGTTGT
GGCTGTGTTCGATTCGAGTAGTGCTGAATTAGTAAAGATGGTTAGAACCGGCCGTGGTTATACTCTGGGGGTGCA
GGAGGCGAATCCGGCGATGAGAGGAGGGTGTGCGGGAATTACTGATAGGTTACGGCCGAGCAGTGATGAGAGATT
TGAAGGTTGGGTTGGGCATGCGGTTTGGTATGGGTTTTGATGGTAAAGATGGTTATTCGAGATGGTTCAAGTGAG
TGAGGATGAAGATGACTATGGGATGAGATGGGTTGAGGTTGATACATGTATCAGGGTAGAGGAGTTGCAACCAGA
AACCAGCGTCAATCCCGTCTTCCATCATGATACCTGCTCAAGACACACGCAAGGGAGGGCTCAAATGACACCATC
TACGAGGGGAAGCCCGCCGAGCCTCCGTGTACATGTACGCACCTCAAAGCCGTCCATCGAATAGAAGCGGAGACA
ACTCGGTAAGATCCCGTCTCGTCAAGTTTCACAACCCGGACTTGAGAATGACGCTACGGCGTATCAAGTCAAGAA
GAGGAAAGAGGAAAAAAGAAAGTAGAACGAAGAGAGTTTGGTCCGTTGCGGGATTGTGGCAAGGGCCATACGGTC
TGCTCGACGGGTTTATGAAGACGGGTTCCCTCTCGTAAATGAATCAAGATCTCTTTAACCATAGATGGACAAAAA
GGTTTCCAAGAAAACATCCGTCTTCTTTATCCTCCATCCTCACCATGACGCACGACACCAAGCCCCAAGCCAGAG
GCTCCTCGAATTCCCCTTCAACTCAAGAAGATTACTTCGTAGGAGTAGAATCGCTCGCCTCAACACCAGGTCAAC
GCGCCCACCACGTCCGCGAAAAAGATGACCTCGAAATCTTCCGAGTCGAACGGTGCGTAAGCAACGCCCAACGCG
AAGCCGGCGCAAAAGCCGAGTCGGAAATGGAAGACGACTACGACGAAGATGAAAACGCGTCGGATAAACAGGGTG
GGAAACATGCGCTCGATAAGCTGCGATCCATGGTGCATAAACTCCCTCGCTTCGTCCGCTACCTCATCTATCTCA
TTCCCGGGGCCGTCTTGCTGCTCATTCCCGTCTTGCTGGGGACGGTGAATACCGATCCGGATAGTCGGTTGCTTG
GCGGGGTCGGGGGTGTCGAACTGATGTGGTTTGGGATCTGGTTGGAGATTATGTGGTGTTCGCTTTGGCTTTCGA
GGTTGGTCACCAGTGCTTTGCCGTATGTGCTTGCTGGGTTGGCTTGGATTATGGCTTCTCATGTTCCGAAGCAGT
GGAAGGAACTTGGGAGGAGGCTGGAGGTTCCCAGTGCCATCTTCTTATGGTTTCTCGCGATACTCATCTCCTTTA
AGCCAACTAACGATGGCCATCACGCTCGATCACCGGGAGAAGACGACGCCGGTCTGGAATGGGTCAACACGGTCA
ACAAGGTCATCATCGCCCTCTTCACACTGGCAACTCTCAACTTTTTAGAAAAGATCATCATCCAGTGGATAGCAA
CCTCGTTCCACCGCCGAACCTACTCAACCCGGATCCAGAACAACAAAGCCGACATCCGACAACTAGCCCAACTCT
ACGAACACGCAAAGGTCAAGCTGAACCACAACCACAGCTTCTTGCAGAACACCGGCCCGGGCGTGGGCGGCTCGA
CGACGACGACGCTGCAGACGCTGCACGAGAACGCTCGGCAGGTGCTCGGCAAGTTCGGACAGGTTGCTGGGAAAG
TAGGCAACGATCTTATCGGGAGGAAAGTTAATATCGATTCGACGCTCAAGATCGTGGAGGAGTTGTTGAGGAGTA
CCATGGCTTCTTATACGCTTGCCAGGTTTATCTATCGGAGTTTGGTGAGGTCTGATCGCGAGACGGTTCATCCCG
AGGATATGAAGGCTGTCTTTAAGACGAAAGAGGAGGTCGACGCTGCCTTCAACGTCTTTGACAAGGATCTCAACG
GCGACATCTCACTGGAAGAGTTTCAAGTCGTCTGCAACGAGATCCACCTCGAGAAGAAAGCCATCGCCGCCTCTC
TCAAAGATCTCGACTCAGTAATCCACAAACTCGACCGCGTCTTTCTCTCCATCAGCATCATCATCGCCGCCGTCG
TCTTCATCGTCACAATGTCCGGTTCCGCAACCGCAGGTCTCGCCTCCGTCGGGAGCACCGTCCTCGGCCTCGCCT
GGATGCTACAGGCCACGGCGCAGGAGTTCCTTCAGTCCATCATCTTCGTCTTCATCAAGCATCCGTTTGACGTGG
GTGATCGCGTCACCATCTACGGATCGACGGGCGCCAAGATGAAGGGGGATGAGTATTACGTTACCGAGATTTCAC
TTCTTTATACCGAGTTTAAGAAGATGCAGGGGCACATCGTGCAGGCGCCTAACTCGTTGCTCAACACGCTGTTCA
TTCTCAACTATCGGCGTTCCAACGGGACTTCGGATCCGATCAGACTGGAGATGCGGTTTGGGACGCCGGCTCATC
AGATTGAAGAGCTCAAGGACAGGTTACTGGCATTTTGTCTGCGGAACAAGAGGGATTTCTACCCCAAGGTCGTGA
CGGAGATGCTTAAACTCGAAGACGTCCGCTCATGCTCCATGAACATCGTCGTCAAGCACAAAGGCAACTTCCAAA
GCGAGACGGTCCGCCAGACCCGTCACAACAAACTGGTGACAGAGATCATGCACCTGATGACGACCATCGGCATAC
AGGGTCCCTACCGCACCGACCCGGGCGGAAGCTACGAGTTCCCCATGTACTGGACCGGCGTCCATCCGCCTCCGT
CTACGGCTCCGGCTCCGGCTCCGGCTCCGGATACGACTCAGGGTCCGACGCCGGGTGACGGCATGCCGACGCCAA
GCGCGCCAACCAGCAGTCTTCCTCAGCCGCCGCCTAGCTTCAGGAGGCGCAGGCGGACGCTCATCGATGACGATG
GGACGGGTGATGCCGAGAACGTGTATGAGCATCGGCGTGACATGGTGGCTTCAAGTCGTAAGATGTCTATCCGCA
GGAAGGAGCGCGGGTTTCGGCTTGAGACGGAGGCTCAGGCTGCGGTCGAGTCGCCGCCGGAGATGCTGTCGAGAT
CGACGTCGAGGGTTTCGGGGACGCCTCCGCGGCCGGGCTTCTTTCAGCGGTCGGCGACTGTGTTTATCAGGGGGA
GCGCGTCTGATCCACCGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail