Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05332
Gene name
Locationscaffold_05:3326002..3326530
Strand+
Gene length (bp)528
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20174 DUF6540 Family of unknown function (DUF6540) 1.2E-07 23 140

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6278 0.7503 0.332 0.0394 0.0212 0.0037 0.1451 0.0582 0.0775 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6267
Ophiocordyceps camponoti-floridani Ophcf2|05332 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5834
Ophiocordyceps kimflemingae Ophio5|1491
Ophiocordyceps kimflemingae Ophio5|4909
Ophiocordyceps subramaniannii Hirsu2|4527
Ophiocordyceps subramaniannii Hirsu2|8822

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05332
MAMLIAIALHHRDHFSHGKARQTFGNEAYHWTINITPEANQSHGCSFEATDATTIDPVTFRMTNPTMDWWFRHEE
DVNLTSSPKLLGSVVIGEVADNMSSAQFRDFFARVRLPAKNTHPQQSCVTWVADAICALQERGWVTKFDIDQFKC
WALSYADERMKGMASTEPIVKYYSI*
Coding >Ophcf2|05332
ATGGCCATGCTCATTGCCATTGCTCTCCACCATAGAGATCATTTCTCACACGGCAAAGCCCGGCAGACGTTCGGC
AACGAAGCCTATCACTGGACCATAAACATCACACCTGAAGCCAATCAAAGCCATGGCTGCTCCTTCGAAGCCACC
GACGCAACTACCATCGACCCTGTCACATTCCGCATGACCAACCCGACCATGGACTGGTGGTTCCGTCACGAAGAG
GACGTAAATCTCACCTCCAGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGAGAGGTAGCGGACAACATGTCGAGT
GCCCAGTTTCGCGACTTTTTTGCTCGAGTGCGTCTGCCGGCCAAGAACACTCATCCGCAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCTGTGCCCTTCAGGAAAGAGGATGGGTAACCAAGTTTGACATTGACCAGTTCAAGTGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGAATGGCTTCGACGGAGCCGATTGTCAAGTACTATTCTATC
TGA
Transcript >Ophcf2|05332
ATGGCCATGCTCATTGCCATTGCTCTCCACCATAGAGATCATTTCTCACACGGCAAAGCCCGGCAGACGTTCGGC
AACGAAGCCTATCACTGGACCATAAACATCACACCTGAAGCCAATCAAAGCCATGGCTGCTCCTTCGAAGCCACC
GACGCAACTACCATCGACCCTGTCACATTCCGCATGACCAACCCGACCATGGACTGGTGGTTCCGTCACGAAGAG
GACGTAAATCTCACCTCCAGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGAGAGGTAGCGGACAACATGTCGAGT
GCCCAGTTTCGCGACTTTTTTGCTCGAGTGCGTCTGCCGGCCAAGAACACTCATCCGCAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCTGTGCCCTTCAGGAAAGAGGATGGGTAACCAAGTTTGACATTGACCAGTTCAAGTGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGAATGGCTTCGACGGAGCCGATTGTCAAGTACTATTCTATC
TGA
Gene >Ophcf2|05332
ATGGCCATGCTCATTGCCATTGCTCTCCACCATAGAGATCATTTCTCACACGGCAAAGCCCGGCAGACGTTCGGC
AACGAAGCCTATCACTGGACCATAAACATCACACCTGAAGCCAATCAAAGCCATGGCTGCTCCTTCGAAGCCACC
GACGCAACTACCATCGACCCTGTCACATTCCGCATGACCAACCCGACCATGGACTGGTGGTTCCGTCACGAAGAG
GACGTAAATCTCACCTCCAGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGAGAGGTAGCGGACAACATGTCGAGT
GCCCAGTTTCGCGACTTTTTTGCTCGAGTGCGTCTGCCGGCCAAGAACACTCATCCGCAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCTGTGCCCTTCAGGAAAGAGGATGGGTAACCAAGTTTGACATTGACCAGTTCAAGTGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGAATGGCTTCGACGGAGCCGATTGTCAAGTACTATTCTATC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail