Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05322
Gene name
Locationscaffold_05:3287689..3290198
Strand-
Gene length (bp)2509
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain 3.1E-112 18 443

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5034 0.6798 0.0464 0.0175 0.0496 0.0033 0.1024 0.0361 0.0174 0.0286

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1409
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4921
Ophiocordyceps australis map64 (Brazil) OphauB2|3814
Ophiocordyceps camponoti-floridani Ophcf2|05322 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5821
Ophiocordyceps kimflemingae Ophio5|6150
Ophiocordyceps subramaniannii Hirsu2|10896

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05322
MESLKIHNSLQPGSPVPFKPIEAGKVSWYACGPTVYDKSHLGHARNYVSTDIIRRILMHYFGFRVRFVMNMTDVD
DKIIIKARRQRLLELEKKKTHSLQDLRALAVAAFQAYAKSNLPLLTADDNQLDEKNYTARRDAAYEKVLAGSTLS
GEGKPGDGEAKIKMHLGNMDAAARALADDAVFPGADEVLLPYLDSLYKETIDTRDQSMFTDLTKSMEDLFTQDMD
NLNVLRPDVITRVTEYMPQIVKFVEQIVDKGFAYEAQGSVYFDIAAFEKAGNKYARLRPDGRNDKSLQDEGEGSL
SKNLAGKKGAGDFALWKRSKAGEPFWTSKWGDGRPGWHIECSVMASDILGSRMDIHSGGIDLAFPHHDNELAQSE
AFFCEGGEHTWVNYFLHMGHLSISGSKMSKSLKNFQTIQDALATSYTARSMRIVFLMGKWNDGVEISPDMRAQAD
NWEATISNFFTNTKAWLAEADDKPKPIDNGVKNLSLDDNKLMADLDQAKDEVESALLNSFDTPRAMLVMLKLVNS
TNAQLKDRQGAIDLSQVEAIARWITKMVGIFGLDANAQPPYDGLGWVSSLAADVDAETAVRPYAAVLDRVRADVT
SLSLSNDGLSTLVAVDPSAESRAAAEEGTRDIEKLALPYLRAVSHIRDELRRTLSTQPPTTKKQVLSLTDAIRDD
HLSRLGVYLDDRPDSQPALIKFVPAADLLAAREEKAAREADKARQKEEARLAREKADKEARDKARVPPEDMFRGD
ERYGEWDGQGLPTRMRDGSDVPKSQMKALKKMWEKQKRVHEELKAKGGL*
Coding >Ophcf2|05322
ATGGAGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAGTCCTGTGCCCTTCAAGCCCATTGAAGCTGGCAAG
GTGTCGTGGTATGCCTGCGGTCCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGAGAAACTACGTGTCGACG
GACATTATCCGTCGCATCTTGATGCACTACTTTGGTTTCCGCGTTCGGTTCGTCATGAACATGACGGATGTCGAC
GACAAGATAATCATCAAGGCGAGGAGACAAAGATTGCTCGAGCTCGAGAAGAAGAAGACGCACTCGCTACAAGAT
CTGAGAGCCTTGGCCGTCGCCGCTTTTCAGGCCTACGCCAAGTCAAACCTCCCCCTTTTAACCGCGGACGATAAC
CAGCTGGACGAGAAGAACTACACTGCACGTCGAGACGCTGCCTACGAAAAGGTGCTGGCGGGGAGCACGCTGTCT
GGGGAGGGCAAGCCCGGCGACGGAGAGGCCAAGATCAAGATGCACCTCGGCAACATGGACGCGGCGGCCCGGGCG
CTGGCCGACGACGCCGTGTTTCCGGGCGCAGATGAGGTTCTCCTACCCTACCTCGACTCCCTCTACAAGGAGACG
ATCGATACCCGAGACCAGTCCATGTTCACGGACCTGACAAAGAGCATGGAGGATCTATTTACCCAAGACATGGAC
AATCTCAACGTGCTAAGGCCGGATGTCATCACCAGAGTGACGGAGTACATGCCACAAATCGTAAAGTTTGTCGAG
CAGATTGTCGACAAGGGCTTCGCGTACGAGGCTCAAGGATCCGTCTACTTCGACATCGCCGCCTTCGAAAAGGCC
GGCAACAAGTACGCCCGGCTGCGACCCGACGGACGCAACGACAAGTCGCTGCAGGACGAAGGCGAGGGCTCGCTA
TCCAAGAACCTGGCCGGCAAGAAGGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTT
TGGACGAGCAAATGGGGCGACGGTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCAGATATCCTTGGC
TCTCGCATGGACATTCACTCGGGCGGCATCGATCTCGCCTTTCCCCATCACGATAACGAGCTGGCTCAAAGCGAA
GCCTTCTTCTGCGAGGGGGGCGAGCATACTTGGGTCAACTACTTCCTGCACATGGGACACCTCTCCATCTCGGGC
TCCAAGATGTCCAAGTCGCTCAAGAACTTCCAGACGATCCAGGATGCGCTGGCAACGTCGTACACGGCCCGGAGC
ATGCGCATCGTCTTTCTGATGGGCAAGTGGAACGATGGCGTCGAGATATCGCCCGATATGAGGGCGCAGGCCGAC
AACTGGGAGGCCACCATCAGCAACTTCTTTACCAACACAAAAGCCTGGCTGGCGGAGGCCGATGACAAGCCAAAG
CCCATCGACAACGGCGTCAAGAACCTATCCCTCGACGACAACAAGCTCATGGCAGACCTAGATCAAGCGAAAGAC
GAGGTCGAATCCGCGCTCCTCAACTCTTTCGATACGCCGCGGGCAATGCTCGTCATGCTCAAGTTAGTCAACTCG
ACAAACGCCCAGCTCAAGGACAGGCAGGGCGCCATCGACCTGAGCCAAGTCGAAGCCATCGCCCGGTGGATCACA
AAGATGGTCGGCATCTTCGGGCTAGACGCCAACGCCCAGCCTCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTG
GCGGCCGACGTCGACGCCGAGACAGCAGTGAGGCCGTACGCAGCGGTCCTGGACAGAGTCAGGGCCGACGTCACG
AGCCTGTCACTATCGAATGATGGACTATCGACGCTCGTCGCGGTAGACCCGAGCGCCGAGTCGCGCGCCGCGGCA
GAAGAGGGAACGCGCGACATAGAGAAGCTCGCCCTCCCATACCTCCGCGCCGTGTCTCACATACGCGACGAGCTA
CGACGCACCCTATCAACCCAACCCCCAACAACCAAGAAGCAAGTCCTATCGCTAACAGACGCCATCCGCGACGAC
CACCTCAGCCGTCTAGGCGTCTACCTCGACGACCGCCCCGACAGCCAGCCCGCGCTCATCAAATTCGTCCCGGCC
GCAGACCTCCTCGCCGCGCGGGAGGAAAAGGCCGCGAGGGAGGCAGACAAGGCGCGACAGAAGGAGGAGGCTAGG
CTGGCGCGCGAGAAGGCCGACAAGGAGGCTAGAGACAAGGCCAGGGTTCCGCCAGAGGACATGTTTCGGGGGGAT
GAGCGGTATGGGGAGTGGGATGGGCAGGGGTTGCCGACGAGGATGAGGGATGGGAGTGATGTGCCCAAGAGTCAG
ATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAGAGGGTGCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG
Transcript >Ophcf2|05322
ATGGAGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAGTCCTGTGCCCTTCAAGCCCATTGAAGCTGGCAAG
GTGTCGTGGTATGCCTGCGGTCCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGAGAAACTACGTGTCGACG
GACATTATCCGTCGCATCTTGATGCACTACTTTGGTTTCCGCGTTCGGTTCGTCATGAACATGACGGATGTCGAC
GACAAGATAATCATCAAGGCGAGGAGACAAAGATTGCTCGAGCTCGAGAAGAAGAAGACGCACTCGCTACAAGAT
CTGAGAGCCTTGGCCGTCGCCGCTTTTCAGGCCTACGCCAAGTCAAACCTCCCCCTTTTAACCGCGGACGATAAC
CAGCTGGACGAGAAGAACTACACTGCACGTCGAGACGCTGCCTACGAAAAGGTGCTGGCGGGGAGCACGCTGTCT
GGGGAGGGCAAGCCCGGCGACGGAGAGGCCAAGATCAAGATGCACCTCGGCAACATGGACGCGGCGGCCCGGGCG
CTGGCCGACGACGCCGTGTTTCCGGGCGCAGATGAGGTTCTCCTACCCTACCTCGACTCCCTCTACAAGGAGACG
ATCGATACCCGAGACCAGTCCATGTTCACGGACCTGACAAAGAGCATGGAGGATCTATTTACCCAAGACATGGAC
AATCTCAACGTGCTAAGGCCGGATGTCATCACCAGAGTGACGGAGTACATGCCACAAATCGTAAAGTTTGTCGAG
CAGATTGTCGACAAGGGCTTCGCGTACGAGGCTCAAGGATCCGTCTACTTCGACATCGCCGCCTTCGAAAAGGCC
GGCAACAAGTACGCCCGGCTGCGACCCGACGGACGCAACGACAAGTCGCTGCAGGACGAAGGCGAGGGCTCGCTA
TCCAAGAACCTGGCCGGCAAGAAGGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTT
TGGACGAGCAAATGGGGCGACGGTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCAGATATCCTTGGC
TCTCGCATGGACATTCACTCGGGCGGCATCGATCTCGCCTTTCCCCATCACGATAACGAGCTGGCTCAAAGCGAA
GCCTTCTTCTGCGAGGGGGGCGAGCATACTTGGGTCAACTACTTCCTGCACATGGGACACCTCTCCATCTCGGGC
TCCAAGATGTCCAAGTCGCTCAAGAACTTCCAGACGATCCAGGATGCGCTGGCAACGTCGTACACGGCCCGGAGC
ATGCGCATCGTCTTTCTGATGGGCAAGTGGAACGATGGCGTCGAGATATCGCCCGATATGAGGGCGCAGGCCGAC
AACTGGGAGGCCACCATCAGCAACTTCTTTACCAACACAAAAGCCTGGCTGGCGGAGGCCGATGACAAGCCAAAG
CCCATCGACAACGGCGTCAAGAACCTATCCCTCGACGACAACAAGCTCATGGCAGACCTAGATCAAGCGAAAGAC
GAGGTCGAATCCGCGCTCCTCAACTCTTTCGATACGCCGCGGGCAATGCTCGTCATGCTCAAGTTAGTCAACTCG
ACAAACGCCCAGCTCAAGGACAGGCAGGGCGCCATCGACCTGAGCCAAGTCGAAGCCATCGCCCGGTGGATCACA
AAGATGGTCGGCATCTTCGGGCTAGACGCCAACGCCCAGCCTCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTG
GCGGCCGACGTCGACGCCGAGACAGCAGTGAGGCCGTACGCAGCGGTCCTGGACAGAGTCAGGGCCGACGTCACG
AGCCTGTCACTATCGAATGATGGACTATCGACGCTCGTCGCGGTAGACCCGAGCGCCGAGTCGCGCGCCGCGGCA
GAAGAGGGAACGCGCGACATAGAGAAGCTCGCCCTCCCATACCTCCGCGCCGTGTCTCACATACGCGACGAGCTA
CGACGCACCCTATCAACCCAACCCCCAACAACCAAGAAGCAAGTCCTATCGCTAACAGACGCCATCCGCGACGAC
CACCTCAGCCGTCTAGGCGTCTACCTCGACGACCGCCCCGACAGCCAGCCCGCGCTCATCAAATTCGTCCCGGCC
GCAGACCTCCTCGCCGCGCGGGAGGAAAAGGCCGCGAGGGAGGCAGACAAGGCGCGACAGAAGGAGGAGGCTAGG
CTGGCGCGCGAGAAGGCCGACAAGGAGGCTAGAGACAAGGCCAGGGTTCCGCCAGAGGACATGTTTCGGGGGGAT
GAGCGGTATGGGGAGTGGGATGGGCAGGGGTTGCCGACGAGGATGAGGGATGGGAGTGATGTGCCCAAGAGTCAG
ATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAGAGGGTGCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG
Gene >Ophcf2|05322
ATGGAGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAGTCCTGTGCCCTTCAAGCCCATTGAAGCTGGCAAG
GTGTCGTGGTATGCCTGCGGTCCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGAGAAACTACGTGTCGACG
GACATTATCCGTCGCATCTTGATGCACTACTTTGGTTTCCGCGTTCGGTTCGTCATGAACATGACGGATGTCGAC
GACAAGGTGAGCGAAGCAAGAATATCGTCTACTTGATGAAAGTCTGACACAAAAACTAGATAATCATCAAGGCGA
GGAGACAAAGATTGCTCGAGCTCGAGAAGAAGAAGACGCACTCGCTACAAGATCTGAGAGCCTTGGCCGTCGCCG
CTTTTCAGGCCTACGCCAAGTCAAACCTCCCCCTTTTAACCGCGGACGATAACCAGCTGGACGAGAAGAACTACA
CTGCACGTCGAGACGCTGCCTACGAAAAGGTGCTGGCGGGGAGCACGCTGTCTGGGGAGGGCAAGCCCGGCGACG
GAGAGGCCAAGATCAAGATGCACCTCGGCAACATGGACGCGGCGGCCCGGGCGCTGGCCGACGACGCCGTGTTTC
CGGGCGCAGATGAGGTTCTCCTACCCTACCTCGACTCCCTCTACAAGGAGACGATCGATACCCGAGACCAGTCCA
TGTTCACGGACCTGACAAAGAGCATGGAGGATCTATTTACCCAAGACATGGACAATCTCAACGTGCTAAGGCCGG
ATGTCATCACCAGAGTGACGGAGTACATGCCACAAATCGTAAAGTTTGTCGAGCAGATTGTCGACAAGGGCTTCG
CGTACGAGGCTCAAGGATCCGTCTACTTCGACATCGCCGCCTTCGAAAAGGCCGGCAACAAGTACGCCCGGCTGC
GACCCGACGGACGCAACGACAAGTCGCTGCAGGACGAAGGCGAGGGCTCGCTATCCAAGAACCTGGCCGGCAAGA
AGGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTTTGGACGAGCAAATGGGGCGACG
GTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCAGATATCCTTGGCTCTCGCATGGACATTCACTCGG
GCGGCATCGATCTCGCCTTTCCCCATCACGATAACGAGCTGGCTCAAAGCGAAGCCTTCTTCTGCGAGGGGGGCG
AGCATACTTGGGTCAACTACTTCCTGCACATGGGACACCTCTCCATCTCGGGCTCCAAGATGTCCAAGTCGCTCA
AGAACTTCCAGACGATCCAGGATGCGCTGGCAACGTCGTACACGGCCCGGAGCATGCGCATCGTCTTTCTGATGG
GCAAGTGGAACGATGGCGTCGAGATATCGCCCGATATGAGGGCGCAGGCCGACAACTGGGAGGCCACCATCAGCG
TACGTCTCTTTCACCCTGACTCCCATAAGCTGTGCTCGTCTGACGTTCTCGGTAGAACTTCTTTACCAACACAAA
AGCCTGGCTGGCGGAGGCCGATGACAAGCCAAAGCCCATCGACAACGGCGTCAAGAACCTATCCCTCGACGACAA
CAAGCTCATGGCAGACCTAGATCAAGCGAAAGACGAGGTCGAATCCGCGCTCCTCAACTCTTTCGATACGCCGCG
GGCAATGCTCGTCATGCTCAAGTTAGTCAACTCGACAAACGCCCAGCTCAAGGACAGGCAGGGCGCCATCGACCT
GAGCCAAGTCGAAGCCATCGCCCGGTGGATCACAAAGATGGTCGGCATCTTCGGGCTAGACGCCAACGCCCAGCC
TCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTGGCGGCCGACGTCGACGCCGAGACAGCAGTGAGGCCGTACGC
AGCGGTCCTGGACAGAGTCAGGGCCGACGTCACGAGCCTGTCACTATCGAATGATGGACTATCGACGCTCGTCGC
GGTAGACCCGAGCGCCGAGTCGCGCGCCGCGGCAGAAGAGGGAACGCGCGACATAGAGAAGCTCGCCCTCCCATA
CCTCCGCGCCGTGTCTCACATACGCGACGAGCTACGACGCACCCTATCAACCCAACCCCCAACAACCAAGAAGCA
AGTCCTATCGCTAACAGACGCCATCCGCGACGACCACCTCAGCCGTCTAGGCGTCTACCTCGACGACCGCCCCGA
CAGCCAGCCCGCGCTCATCAAATTCGTCCCGGCCGCAGACCTCCTCGCCGCGCGGGAGGAAAAGGCCGCGAGGGA
GGCAGACAAGGCGCGACAGAAGGAGGAGGCTAGGCTGGCGCGCGAGAAGGCCGACAAGGAGGCTAGAGACAAGGC
CAGGGTTCCGCCAGAGGACATGTTTCGGGGGGATGAGCGGTATGGGGAGTGGGATGGGCAGGGGTTGCCGACGAG
GATGAGGGATGGGAGTGATGTGCCCAAGAGTCAGATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAGAGGGT
GCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail