Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05319
Gene name
Locationscaffold_05:3279210..3280806
Strand-
Gene length (bp)1596
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 6.1E-84 33 284

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0913 0.1721 0.9566 0.1653 0.0375 0.0032 0.0868 0.1326 0.0501 0.001

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.998075

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6175
Ophiocordyceps australis map64 (Brazil) OphauB2|1713
Ophiocordyceps camponoti-floridani Ophcf2|05319 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5818
Ophiocordyceps kimflemingae Ophio5|3770
Ophiocordyceps subramaniannii Hirsu2|784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05319
MKTSTTLCAAFAAGANAFWRMECPGRVGLARIDPIVNPDEISNHVHSIAGSSAFSESSNYTDLVNGKCTSCRVKQ
DKSSYWHPALYFKDSTTNKYEVVEQVGGMLAYYLLNGDHITAFPPGFRMLSGNTNRNSYSLGDASHPDPDKSAWA
SMGQTTQEDLAQRAIGFNCLNYGKAPEGTLFRHFLPDKQYLDANCKDGVRFEIMFPSCWKGGDAVDSPNHQDHVA
FPDLVMTGTCPPTHPKRLPGLLYEVIWNTEAFKDRQGKFVLSNGDSTGYAYHGDFMMGWDPVFLQKAVDTCTNDS
GRIEDCPLFDIIDKAEACQCSLEGPMPESVSKEDVKGPMDKLPGGMDSHPIKEKPVSGPVPTLHYTPGHKPTDPA
APLPGDVFKQKAAQAAEAAVLPAMMNAEQAPAPTSAPAPAAAAPAEDNKSYYSTQYVTNGNVVSKILVEAQTVYV
SQYAEPTSQAEQNRRRAVHMHKHAHFRRRQ*
Coding >Ophcf2|05319
ATGAAGACCTCGACTACCCTCTGTGCCGCCTTCGCCGCTGGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATCGTTAACCCCGACGAGATCTCCAACCACGTCCACTCCATTGCCGGT
TCCTCCGCCTTCTCGGAGAGCTCCAACTACACGGATCTCGTCAACGGCAAGTGCACTTCTTGCCGCGTCAAGCAG
GACAAGTCGTCATACTGGCACCCGGCCCTCTACTTCAAGGACTCGACAACCAACAAGTACGAGGTTGTCGAGCAG
GTTGGCGGCATGCTTGCTTACTACTTACTCAATGGCGACCACATCACCGCCTTCCCGCCCGGCTTCCGCATGCTG
TCGGGAAACACCAACAGGAACTCGTACTCGCTCGGCGACGCCAGCCATCCTGATCCAGACAAGTCGGCCTGGGCC
TCGATGGGCCAGACGACGCAAGAGGACCTTGCCCAGCGCGCCATCGGCTTCAACTGCCTCAACTACGGCAAGGCT
CCCGAGGGCACCCTGTTCCGCCACTTCCTTCCCGACAAGCAGTACCTCGACGCCAACTGCAAGGACGGCGTTCGA
TTCGAAATCATGTTCCCTTCGTGCTGGAAGGGTGGCGATGCTGTCGACAGTCCCAACCACCAGGACCACGTCGCC
TTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCAAGCGCCTGCCCGGCCTCCTGTACGAGGTC
ATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCCTCTCCAACGGCGACTCGACCGGTTACGCC
TACCATGGTGACTTCATGATGGGCTGGGACCCGGTTTTCCTCCAGAAGGCCGTTGACACGTGCACCAACGACTCT
GGCCGGATCGAGGATTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGGCCCC
ATGCCCGAATCGGTCTCCAAGGAAGACGTCAAGGGCCCGATGGACAAGCTGCCCGGCGGCATGGACAGTCACCCT
ATCAAGGAGAAGCCGGTCTCCGGCCCGGTGCCCACTCTCCACTACACGCCAGGCCACAAGCCCACTGACCCCGCC
GCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCCTTCCTGCCATGATG
AACGCCGAGCAGGCGCCGGCTCCGACGTCTGCGCCTGCGCCTGCTGCCGCTGCCCCTGCCGAGGACAACAAAAGC
TACTATAGCACCCAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTACGTG
TCTCAGTACGCGGAGCCAACGTCCCAGGCTGAACAGAACCGCCGCCGGGCCGTCCACATGCACAAGCACGCGCAC
TTCCGCCGCCGGCAATAA
Transcript >Ophcf2|05319
ATGAAGACCTCGACTACCCTCTGTGCCGCCTTCGCCGCTGGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATCGTTAACCCCGACGAGATCTCCAACCACGTCCACTCCATTGCCGGT
TCCTCCGCCTTCTCGGAGAGCTCCAACTACACGGATCTCGTCAACGGCAAGTGCACTTCTTGCCGCGTCAAGCAG
GACAAGTCGTCATACTGGCACCCGGCCCTCTACTTCAAGGACTCGACAACCAACAAGTACGAGGTTGTCGAGCAG
GTTGGCGGCATGCTTGCTTACTACTTACTCAATGGCGACCACATCACCGCCTTCCCGCCCGGCTTCCGCATGCTG
TCGGGAAACACCAACAGGAACTCGTACTCGCTCGGCGACGCCAGCCATCCTGATCCAGACAAGTCGGCCTGGGCC
TCGATGGGCCAGACGACGCAAGAGGACCTTGCCCAGCGCGCCATCGGCTTCAACTGCCTCAACTACGGCAAGGCT
CCCGAGGGCACCCTGTTCCGCCACTTCCTTCCCGACAAGCAGTACCTCGACGCCAACTGCAAGGACGGCGTTCGA
TTCGAAATCATGTTCCCTTCGTGCTGGAAGGGTGGCGATGCTGTCGACAGTCCCAACCACCAGGACCACGTCGCC
TTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCAAGCGCCTGCCCGGCCTCCTGTACGAGGTC
ATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCCTCTCCAACGGCGACTCGACCGGTTACGCC
TACCATGGTGACTTCATGATGGGCTGGGACCCGGTTTTCCTCCAGAAGGCCGTTGACACGTGCACCAACGACTCT
GGCCGGATCGAGGATTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGGCCCC
ATGCCCGAATCGGTCTCCAAGGAAGACGTCAAGGGCCCGATGGACAAGCTGCCCGGCGGCATGGACAGTCACCCT
ATCAAGGAGAAGCCGGTCTCCGGCCCGGTGCCCACTCTCCACTACACGCCAGGCCACAAGCCCACTGACCCCGCC
GCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCCTTCCTGCCATGATG
AACGCCGAGCAGGCGCCGGCTCCGACGTCTGCGCCTGCGCCTGCTGCCGCTGCCCCTGCCGAGGACAACAAAAGC
TACTATAGCACCCAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTACGTG
TCTCAGTACGCGGAGCCAACGTCCCAGGCTGAACAGAACCGCCGCCGGGCCGTCCACATGCACAAGCACGCGCAC
TTCCGCCGCCGGCAATAA
Gene >Ophcf2|05319
ATGAAGACCTCGACTACCCTCTGTGCCGCCTTCGCCGCTGGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATCGTTAACCCCGACGAGATCTCCAACCACGTCCACTCCATTGCCGGT
TCCTCCGGTAAGTCCTTCTCTCGGCAAAGTCTTCAGGTTCCCGCTGACTCGGCACAGCCTTCTCGGAGAGCTCCA
ACTACACGGATCTCGTCAACGGCAAGTGCACTTCTTGCCGCGTCAAGCAGGACAAGTCGTCATACTGGCACCCGG
CCCTCTACTTCAAGGACTCGACAACCAACAAGTACGAGGTTGTCGAGCAGGTTGGCGGCATGCTTGCGTAGGTTT
CTTCCATCAACCCGCCATATGATGGTGTCTGACCGCCACCGCTCAGTTACTACTTACTCAATGGCGACCACATCA
CCGCCTTCCCGCCCGGCTTCCGCATGCTGTCGGGAAACACCAACAGGAACTCGTACTCGCTCGGCGACGCCAGCC
ATCCTGATCCAGACAAGTCGGCCTGGGCCTCGATGGGCCAGACGACGCAAGAGGACCTTGCCCAGCGCGCCATCG
GCTTCAACTGCCTCAACTACGGCAAGGCTCCCGAGGGCACCCTGTTCCGCCACTTCCTTCCCGACAAGCAGTACC
TCGACGCCAACTGCAAGGACGGCGTTCGATTCGAAATCATGTTCCCTTCGTGCTGGAAGGGTGGCGATGCTGTCG
ACAGTCCCAACCACCAGGACCACGTCGCCTTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCA
AGCGCCTGCCCGGCCTCCTGTACGAGGTCATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCC
TCTCCAACGGCGACTCGACCGGTAAGCGGACAGCTTGCACTCCTCTCCTGTTTCCTTCTGACGCGCGCAGGTTAC
GCCTACCATGGTGACTTCATGATGGGCTGGGACCCGGTTTTCCTCCAGAAGGCCGTTGACACGTGCACCAACGAC
TCTGGCCGGATCGAGGATTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGGC
CCCATGCCCGAATCGGTCTCCAAGGAAGACGTCAAGGGCCCGATGGACAAGCTGCCCGGCGGCATGGACAGTCAC
CCTATCAAGGAGAAGCCGGTCTCCGGCCCGGTGCCCACTCTCCACTACACGCCAGGCCACAAGCCCACTGACCCC
GCCGCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCCTTCCTGCCATG
ATGAACGCCGAGCAGGCGCCGGCTCCGACGTCTGCGCCTGCGCCTGCTGCCGCTGCCCCTGCCGAGGACAACAAA
AGCTACTATAGCACCCAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTAC
GTGTCTCAGTACGCGGAGCCAACGTCCCAGGCTGAACAGAACCGCCGCCGGGCCGTCCACATGCACAAGCACGCG
CACTTCCGCCGCCGGCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail