Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05318
Gene name
Locationscaffold_05:3276397..3278249
Strand-
Gene length (bp)1852
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 157.57 90.49 224.65
Alive In ants, during behavior modification 8.87 1.91 15.82
Dead In ants, recently dead 7.48 1.23 13.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.624945 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05318
MTSRLTARGLELGASLSLGWLLVIILGGGVIVFTGLGLGLAWRLKRIRRRRQRQRDSDMRMGVYCGGETSRTRLT
KMSGGGLGSSIPACFRFSSSALFGTRLSSSVSVRLSFRTPQRDQLHEKRLSPAQLPQVSPVRSLAQGQPLSPQRG
KIHEQQLSPQRDKVHEQQLPPAQLPQLSPVRSPAQEQQLSPPQLPPLSPQRDQLHDKRLTPAQLPKLNPVPSPAH
EQQLKPPSSHH*
Coding >Ophcf2|05318
ATGACATCCCGCCTCACCGCCCGAGGTCTCGAGCTCGGCGCCAGCCTCAGCCTCGGCTGGCTCCTGGTAATCATC
CTCGGCGGAGGCGTAATCGTCTTCACGGGTCTAGGTCTAGGCCTAGCCTGGCGATTGAAGCGGATCCGACGACGA
CGACAGCGGCAGCGAGATTCGGATATGCGGATGGGTGTTTACTGCGGCGGCGAGACTTCGCGGACGAGACTTACA
AAGATGTCTGGCGGGGGGTTGGGCAGCAGCATCCCGGCCTGCTTCAGATTCAGCAGTTCGGCCCTGTTCGGAACT
CGGCTGTCGAGCAGCGTCTCAGTGCGCCTCAGCTTCCGCACCCCTCAGAGAGACCAGCTACATGAGAAGCGGCTC
AGTCCGGCTCAGCTCCCGCAAGTCAGTCCGGTTCGGAGTTTAGCTCAGGGGCAGCCCCTCAGCCCTCAACGAGGC
AAAATACACGAGCAGCAACTCAGCCCTCAACGAGACAAAGTGCACGAGCAGCAACTCCCTCCGGCTCAGCTCCCG
CAACTCAGTCCCGTTCGGAGTCCAGCTCAGGAGCAACAGCTGAGCCCTCCCCAGCTCCCACCACTAAGCCCCCAG
CGAGACCAACTACACGACAAGCGGCTCACTCCAGCTCAGCTCCCGAAACTCAATCCCGTTCCGAGTCCAGCTCAC
GAGCAGCAACTGAAACCCCCCAGCTCCCACCACTAA
Transcript >Ophcf2|05318
ATGACATCCCGCCTCACCGCCCGAGGTCTCGAGCTCGGCGCCAGCCTCAGCCTCGGCTGGCTCCTGGTAATCATC
CTCGGCGGAGGCGTAATCGTCTTCACGGGTCTAGGTCTAGGCCTAGCCTGGCGATTGAAGCGGATCCGACGACGA
CGACAGCGGCAGCGAGATTCGGATATGCGGATGGGTGTTTACTGCGGCGGCGAGACTTCGCGGACGAGACTTACA
AAGATGTCTGGCGGGGGGTTGGGCAGCAGCATCCCGGCCTGCTTCAGATTCAGCAGTTCGGCCCTGTTCGGAACT
CGGCTGTCGAGCAGCGTCTCAGTGCGCCTCAGCTTCCGCACCCCTCAGAGAGACCAGCTACATGAGAAGCGGCTC
AGTCCGGCTCAGCTCCCGCAAGTCAGTCCGGTTCGGAGTTTAGCTCAGGGGCAGCCCCTCAGCCCTCAACGAGGC
AAAATACACGAGCAGCAACTCAGCCCTCAACGAGACAAAGTGCACGAGCAGCAACTCCCTCCGGCTCAGCTCCCG
CAACTCAGTCCCGTTCGGAGTCCAGCTCAGGAGCAACAGCTGAGCCCTCCCCAGCTCCCACCACTAAGCCCCCAG
CGAGACCAACTACACGACAAGCGGCTCACTCCAGCTCAGCTCCCGAAACTCAATCCCGTTCCGAGTCCAGCTCAC
GAGCAGCAACTGAAACCCCCCAGCTCCCACCACTAA
Gene >Ophcf2|05318
ATGACATCCCGCCTCACCGCCCGAGGTCTCGAGCTCGGCGCCAGCCTCAGCCTCGGCTGGCTCCTGGTAATCATC
CTCGGCGGAGGCGTAATCGTCTTCACGGGTCTAGGTCTAGGCCTAGCCTGGCGATTGAAGCGGATCCGACGACGA
CGACAGCGGCAGCGAGATTCGGATATGCGGATGGGTGTTTACTGCGGCGGCGAGACTTCGCGGACGAGACTTACA
AAGATGTCTGGCGGGTATCTGCCCGCTTTGTCGAGTGGGGGGTCTTTGGGGTTTGCGTCTGATGAAGGGGGGGTT
AAAGAGGTGGTTGAAGGGAAGATTGGGATTCCGGCTGCGGCGAAGATGGTTCGTAAGTCTGTTACTGATTCGGAT
TTACGGCTTATTCTTCGGTCTACGGATGAGAGGTTACGGACTCGCAGCCAAAGTCCCAGCAAGACTCACCCGAAC
AGCGCGCCAACTTCACCAACAAAGACAGCCTCCTCACCCCGCAAGCAACCCGCACCAACCAAGGCGACAGACGCG
CTTCTCTCGACGGCGACGAACCAGCTTGATGATGCGGAGAGGGTGGAGTGGCAGAGTAGGTTGAGTCCCTTGCGG
GGGGGGTCGCCGCGGAGGAGATCGAGGGGGAGTTCGCTTTCGAGTACGCTTTCTACGCTTTATAGTGTTGAGGAG
GAGGGGAAGGGAGGGGGAGGGGAGGGGGTTGAGGAGAGGGATCACGTTTATTTCCATGCGGTTGGGAGTCCCGTT
CGGGGGGGGAGGGGCGGTTGGGTCAAGTTGAGTCAACAGCAAAAGCAGGGCGGTCCGGTCCAACTCCCTGCTCAA
CAAAGACTCAGCCAGCTACAGCCTCAACAGAGGCTCAGCCCGGCTCAGCAACAACAGCCTTCACAAGGACTCAAT
CCCAACCAACAACCTCCCAGAGCCCCCCCTTTCCCACCCCCCCCGAAACAACCCCGTCCATCAAGCCAGTCCGGA
AGCCCAACTCAGCCCCACGCAGCAGGCCGTCGTGAAGCAACGGCAAAGCCCGACGCGGAAGTCTCTCGGCAGTCC
TGCGAGCTTGCAGCAGCGGGGTGCGCCCGTGCAGGGAGAGGGGGTTCAGCAGGGGAAGCTTGGTTCGCTTCCGCT
TTTTTCGCGGTTTGGAGCCGATGGGAATCGCGGGCTTGAGATGCAGCTTGATCCGAGTTTGTTTCCGCGGGGGAG
TCCTCGACGGGAACAGGGGGTTGGGCAGCAGCATCCCGGCCTGCTTCAGATTCAGCAGTTCGGCCCTGTTCGGAA
CTCGGCTGTCGAGCAGCGTCTCAGTGCGCCTCAGCTTCCGCACGTCAGTCCTCGGCGAAGCAAGCAGCAACTTCG
CTCCCCGCAGCTCCCGCTACTCAGCCCTCAGAGAGACCAGCTACATGAGAAGCGGCTCAGTCCGGCTCAGCTCCC
GCAAGTCAGTCCGGTTCGGAGTTTAGCTCAGGGGCAGCCCCTCAGCCCTCAACGAGGCAAAGTACACGAGCAGCA
ACTCAGCCCTCAACGAGACAAGATACACGAGCAGCAACTCAGCCCTCAACGAGACAAAGTGCACGAGCAGCAACT
CAGCCCTCAACGAGACAAGATACACGAGCAGCAACTCAGCCCTCAACGAGACAAAGTGCACGAGCAGCAACTCCC
TCCGGCTCAGCTCCCGCAACTCAGTCCCGTTCGGAGTCCAGCTCAGGAGCAACAGCTGAGCCCTCCCCAGCTCCC
ACCACTAAGCCCCCAGCGAGACCAACTACACGACAAGCGGCTCACTCCAGCTCAGCTCCCGAAACTCAATCCCGT
TCCGAGTCCAGCTCACGAGCAGCAACTGAAACCCCCCAGCTCCCACCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail