Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05304
Gene name
Locationscaffold_05:3198240..3198786
Strand+
Gene length (bp)546
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.4E-11 51 111
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.9E-11 56 139
PF13637 Ank_4 Ankyrin repeats (many copies) 8.7E-11 54 105
PF13637 Ank_4 Ankyrin repeats (many copies) 9.4E-09 86 138
PF13857 Ank_5 Ankyrin repeats (many copies) 1.9E-10 72 125
PF00023 Ank Ankyrin repeat 8.4E-06 84 110
PF13606 Ank_3 Ankyrin repeat 1.5E-04 84 109

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6762 0.573 0.0079 0.0929 0.3127 0.0066 0.1599 0.1575 0.0628 0.0958

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4358
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3087
Ophiocordyceps australis map64 (Brazil) OphauB2|1738
Ophiocordyceps camponoti-floridani Ophcf2|05304 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|355
Ophiocordyceps kimflemingae Ophio5|2372
Ophiocordyceps subramaniannii Hirsu2|8982

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05304
MAPKLSEDEIDDIIYFSRTGETTTLLETLTTLSTREKTSPTQILNATRDDSSSTPLHMSSANGHLETTRAILALG
PSVDAVNGHGNTALHWAALGGHLAVVRLLVESGASAVVVNESGQMALDMALRGDKLDVVDFFLGGKGDVGEAEME
KLGLEEGHCSS*
Coding >Ophcf2|05304
ATGGCACCGAAGCTATCAGAAGACGAAATCGACGACATAATCTACTTCTCCCGCACAGGCGAAACAACAACCCTC
CTCGAAACCCTCACAACCCTCTCCACCCGAGAAAAAACATCACCAACCCAAATCCTCAACGCCACCCGCGATGAT
TCCTCCTCGACACCCCTACACATGTCCTCCGCAAACGGTCACCTAGAGACTACGCGCGCGATACTGGCGCTGGGA
CCGTCCGTCGATGCGGTCAACGGGCATGGGAACACGGCTCTGCATTGGGCGGCGTTGGGTGGACACCTTGCCGTT
GTGAGACTTTTGGTTGAGAGTGGTGCTTCGGCGGTGGTGGTGAATGAGAGTGGGCAGATGGCGCTGGATATGGCG
CTGAGGGGTGATAAGCTTGATGTTGTTGATTTCTTCCTTGGGGGGAAGGGGGATGTCGGGGAGGCGGAGATGGAG
AAGCTTGGGCTAGAAGAGGGTCATTGTTCGAGCTGA
Transcript >Ophcf2|05304
ATGGCACCGAAGCTATCAGAAGACGAAATCGACGACATAATCTACTTCTCCCGCACAGGCGAAACAACAACCCTC
CTCGAAACCCTCACAACCCTCTCCACCCGAGAAAAAACATCACCAACCCAAATCCTCAACGCCACCCGCGATGAT
TCCTCCTCGACACCCCTACACATGTCCTCCGCAAACGGTCACCTAGAGACTACGCGCGCGATACTGGCGCTGGGA
CCGTCCGTCGATGCGGTCAACGGGCATGGGAACACGGCTCTGCATTGGGCGGCGTTGGGTGGACACCTTGCCGTT
GTGAGACTTTTGGTTGAGAGTGGTGCTTCGGCGGTGGTGGTGAATGAGAGTGGGCAGATGGCGCTGGATATGGCG
CTGAGGGGTGATAAGCTTGATGTTGTTGATTTCTTCCTTGGGGGGAAGGGGGATGTCGGGGAGGCGGAGATGGAG
AAGCTTGGGCTAGAAGAGGGTCATTGTTCGAGCTGA
Gene >Ophcf2|05304
ATGGCACCGAAGCTATCAGAAGACGAAATCGACGACATAATCTACTTCTCCCGCACAGGCGAAACAACAACCCTC
CTCGAAACCCTCACAACCCTCTCCACCCGAGAAAAAACATCACCAACCCAAATCCTCAACGCCACCCGCGATGAT
TCCTCCTCGACACCCCTACACATGTCCTCCGCAAACGGTCACCTAGGTAGGGAGATACCTACCCTTCCATCTCGG
CTCCCCATCCCGCCAACCTAACGAGGCGCAGAGACTACGCGCGCGATACTGGCGCTGGGACCGTCCGTCGATGCG
GTCAACGGGCATGGGAACACGGCTCTGCATTGGGCGGCGTTGGGTGGACACCTTGCCGTTGTGAGACTTTTGGTT
GAGAGTGGTGCTTCGGCGGTGGTGGTGAATGAGAGTGGGCAGATGGCGCTGGATATGGCGCTGAGGGGTGATAAG
CTTGATGTTGTTGATTTCTTCCTTGGGGGGAAGGGGGATGTCGGGGAGGCGGAGATGGAGAAGCTTGGGCTAGAA
GAGGGTCATTGTTCGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail