Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05303
Gene name
Locationscaffold_05:3196637..3198103
Strand+
Gene length (bp)1466
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04406 TP6A_N Type IIB DNA topoisomerase 4.9E-19 87 147

GO

GO Term Description Terminal node
GO:0005694 chromosome Yes
GO:0005524 ATP binding Yes
GO:0003824 catalytic activity Yes
GO:0006259 DNA metabolic process Yes
GO:0003677 DNA binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005575 cellular_component No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043226 organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.667 0.7774 0.0427 0.0448 0.3477 0.0028 0.0648 0.1825 0.0617 0.0161

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4357
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3086
Ophiocordyceps australis map64 (Brazil) OphauB2|1737
Ophiocordyceps camponoti-floridani Ophcf2|05303 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|356
Ophiocordyceps kimflemingae Ophio5|2371
Ophiocordyceps subramaniannii Hirsu2|8981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05303
MPSLPRVGSSTQGSHTDWSSLSVASPGTLINRIENLMASMVDALSRGEPMSIELASRRSLRRLNSLDGHPRRQLI
SFPGKTLAEADKFTRVLLILQLSHDALVFGDVLTKRQIYYQYQDLFDKQRVVDDLVDDIALTLGIYRDDMNIVAS
AKGFLSGRMSIRLKDGPVIDASLGDVGTPIPSVASISTVDCSGLRWVLVVEKDATFRSLVSSRFSETSIAGTGLL
ITAKGYPDLATRTFLQRMHDRHADIPIMLLADLDPDGLNIVRCYRFGADSLADETTSHNRGIHWLGIKTHHVQSA
ASTVKSQQRKTSISSTACRDPVSLLSARDRRMARHTLARIAARCPEADPVAEQLRSQTQTMLMMNVKAEMQWLDD
AGDLTDWLDEQLVDALYG*
Coding >Ophcf2|05303
ATGCCATCTCTCCCTCGCGTCGGCTCCAGCACACAGGGCTCTCACACAGACTGGAGCAGCCTCTCAGTCGCCTCC
CCCGGCACATTGATCAACCGCATCGAGAATCTCATGGCGTCAATGGTGGATGCCTTGTCGAGGGGCGAGCCCATG
AGCATCGAGCTAGCTTCGCGAAGGAGCTTGCGAAGACTAAACTCGCTAGACGGCCACCCTCGACGTCAGCTGATA
AGCTTTCCCGGAAAGACGCTGGCTGAGGCGGACAAGTTCACTCGCGTTCTCTTGATCCTTCAGTTGTCTCACGAT
GCCTTGGTCTTTGGAGATGTTCTGACCAAGCGACAAATCTACTACCAGTATCAAGACCTTTTCGACAAGCAGCGG
GTTGTCGACGACTTGGTCGACGACATCGCCCTGACACTAGGCATTTATCGCGATGACATGAATATTGTTGCGTCT
GCCAAGGGTTTTCTCTCTGGCCGCATGTCGATCCGGCTCAAGGACGGGCCCGTGATCGACGCCTCGCTGGGAGAC
GTGGGCACCCCGATTCCTAGCGTGGCGTCCATCTCCACCGTCGACTGCAGCGGGCTGAGATGGGTTCTGGTGGTG
GAAAAAGACGCCACTTTCCGCTCCCTGGTATCGTCTCGCTTCTCAGAGACATCCATAGCAGGTACCGGCCTGCTC
ATCACCGCAAAAGGCTACCCAGACCTAGCAACGCGAACTTTCCTACAAAGAATGCACGACCGCCATGCAGACATC
CCCATCATGCTGCTAGCCGACCTCGATCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGC
CTCGCCGACGAAACAACAAGCCACAACCGCGGCATCCACTGGCTAGGCATCAAAACACATCACGTCCAATCCGCA
GCATCCACCGTCAAAAGCCAACAGCGCAAAACATCCATCTCGTCGACTGCATGCCGCGATCCCGTCTCCCTCCTC
AGCGCGCGGGATCGCAGAATGGCACGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCGGACCCAGTG
GCAGAACAGCTCCGATCGCAGACGCAGACGATGCTCATGATGAACGTCAAGGCTGAGATGCAGTGGCTCGATGAT
GCAGGGGATTTGACCGACTGGCTGGACGAGCAGCTGGTCGACGCTTTGTACGGCTAG
Transcript >Ophcf2|05303
ATGCCATCTCTCCCTCGCGTCGGCTCCAGCACACAGGGCTCTCACACAGACTGGAGCAGCCTCTCAGTCGCCTCC
CCCGGCACATTGATCAACCGCATCGAGAATCTCATGGCGTCAATGGTGGATGCCTTGTCGAGGGGCGAGCCCATG
AGCATCGAGCTAGCTTCGCGAAGGAGCTTGCGAAGACTAAACTCGCTAGACGGCCACCCTCGACGTCAGCTGATA
AGCTTTCCCGGAAAGACGCTGGCTGAGGCGGACAAGTTCACTCGCGTTCTCTTGATCCTTCAGTTGTCTCACGAT
GCCTTGGTCTTTGGAGATGTTCTGACCAAGCGACAAATCTACTACCAGTATCAAGACCTTTTCGACAAGCAGCGG
GTTGTCGACGACTTGGTCGACGACATCGCCCTGACACTAGGCATTTATCGCGATGACATGAATATTGTTGCGTCT
GCCAAGGGTTTTCTCTCTGGCCGCATGTCGATCCGGCTCAAGGACGGGCCCGTGATCGACGCCTCGCTGGGAGAC
GTGGGCACCCCGATTCCTAGCGTGGCGTCCATCTCCACCGTCGACTGCAGCGGGCTGAGATGGGTTCTGGTGGTG
GAAAAAGACGCCACTTTCCGCTCCCTGGTATCGTCTCGCTTCTCAGAGACATCCATAGCAGGTACCGGCCTGCTC
ATCACCGCAAAAGGCTACCCAGACCTAGCAACGCGAACTTTCCTACAAAGAATGCACGACCGCCATGCAGACATC
CCCATCATGCTGCTAGCCGACCTCGATCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGC
CTCGCCGACGAAACAACAAGCCACAACCGCGGCATCCACTGGCTAGGCATCAAAACACATCACGTCCAATCCGCA
GCATCCACCGTCAAAAGCCAACAGCGCAAAACATCCATCTCGTCGACTGCATGCCGCGATCCCGTCTCCCTCCTC
AGCGCGCGGGATCGCAGAATGGCACGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCGGACCCAGTG
GCAGAACAGCTCCGATCGCAGACGCAGACGATGCTCATGATGAACGTCAAGGCTGAGATGCAGTGGCTCGATGAT
GCAGGGGATTTGACCGACTGGCTGGACGAGCAGCTGGTCGACGCTTTGTACGGCTAG
Gene >Ophcf2|05303
ATGCCATCTCTCCCTCGCGTCGGCTCCAGCACACAGGGCTCTCACACAGACTGGAGCAGCCTCTCAGTCGCCTCC
CCCGGCACATTGATCAACCGCATCGAGAATCTCATGGCGTCAATGGTGGATGCCTTGTCGAGGGGCGAGCCCATG
AGCATCGAGCTAGCTTCGCGAAGGAGCTTGCGAAGACTAAACTCGCTAGACGGCCACCCTCGACGTCAGCTGATA
AGCTTTCCCGGAAAGACGCTGGCTGAGGCGGACAAGTTCAGTACGTGGGCTTCCTGTTGGCCGGACTGCGTTCTC
ACAGCGCAGCTCGCGTTCTCTTGATCCTTCAGTTGTCTCACGATGCCTTGGTCTTTGGAGATGTTCTGACCAAGC
GGTTCGTCTCTCGCATCCCTTATCATCCAATCATTGCGTTGACATGCCGTCCGTTAGACAAATCTACTACCAGTA
TCAAGACCTTTTCGACAAGCAGCGGGTTGTCGACGACTTGGTCGACGACATCGCCCTGACACTAGGCATTTATCG
CGATGACATGAATATTGTAAGACGACGCGCTCTCCGATGAGCACACTAACTTTGACAGGTTGCGTCTGCCAAGGG
TTTTCTCTCTGGCCGCATGTCGATCCGGCTCAAGGACGGGCCCGTGATCGACGCCTCGCTGGGAGACGTGGTAGG
CGTCTTTCACGGTCGTCTCATGTAAACGACTATCTGACGAGCTAGGGCACCCCGATTCCTAGCGTGGCGTCCATC
TCCACCGTCGACTGCAGCGGGCTGAGATGGGTTCTGGTGGTGGAAAAAGACGTACGTCAGAATCTACCACGATCT
GGCCAATCTGATAGCGTCCAGGCCACTTTCCGCTCCCTGGTATCGTCTCGCTTCTCAGAGACATCCATAGCAGGT
ACCGGCCTGCTCATCACCGTACGTCCAAGCCAGCCACGACAACAAGTCCAAACTAACAGACACAGGCAAAAGGCT
ACCCAGACCTAGCAACGCGAACTTTCCTACAAAGAATGCACGACCGCCATGCAGACATCCCCATCATGCTGCTAG
CCGACCTCGATCCCGATGGCCTCAACATCGTCCGCTGCTACCGCTTCGGAGCCGACAGCCTCGCCGACGAAACAA
CAAGCCACAACCGCGGCATCCACTGGCTAGGCATCAAAACACATCACGTCCAATCCGCAGCATCCACCGTCAAAA
GCCAACAGCGCAAAACATCCATCTCGTCGACTGCATGCCGCGATCCCGTCTCCCTCCTCAGCGCGCGGGATCGCA
GAATGGCACGGCACACGCTCGCCCGCATCGCAGCCCGATGCCCGGAAGCGGACCCAGTGGCAGAACAGCTCCGAT
CGCAGACGCAGACGATGCTCATGATGAACGTCAAGGCTGAGATGCAGTGGCTCGATGATGCAGGGGATTTGACCG
ACTGGCTGGACGAGCAGCTGGTCGACGCTTTGTACGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail