Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05302
Gene name
Locationscaffold_05:3193886..3196224
Strand-
Gene length (bp)2338
Transcript length (bp)2220
Coding sequence length (bp)2220
Protein length (aa) 740

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13243 SQHop_cyclase_C Squalene-hopene cyclase C-terminal domain 5.8E-43 403 733
PF13249 SQHop_cyclase_N Squalene-hopene cyclase N-terminal domain 1.7E-35 100 294
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 5.9E-08 140 180
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 6.7E-09 576 616
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.5E-09 626 672

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4893 0.1229 0.0187 0.1191 0.1596 0.024 0.5116 0.158 0.3007 0.1606

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5727
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2595
Ophiocordyceps australis map64 (Brazil) OphauB2|1719
Ophiocordyceps camponoti-floridani Ophcf2|05302 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|357
Ophiocordyceps subramaniannii Hirsu2|8978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05302
MASATGRDSNAGTRRRAAGPEPSFPARPQLEEKTDPKRWRLKDNDSCHTWHYLRDDEAVKDWPQSDAEKYFLGLP
MNLPDLPPAKTPLEAARNGLTFFEKLQLPSGHWACEYGGPMFLLPGIVIAWYVTRTTIPAAHATEIRNYLYARAH
PDDGGWGLHIEGESTVFGTSLNYTVLRLLGVDPDEPAMMKARATLHRLGGALRAPHWAKFWLAVLGVVDWDIVNP
VPPELWLLPDWVPIAPWRWWIHIRQVFLPMGYLYSKRWSCRETDVTRALKRELFVEPYDDIVWAAHRNSISAVDN
YHPKSWLLNTANWFLVNIWNPYLRLNLIKERAEDWTSKLVDMEDANTDYADLAPVNAPMNTIVCFARDGAGSYSV
RRHLERLEEFLWVKDEGMLCNGTNGVQCWDTAFLVQAVFEAGLQDDDRWRPMLRRALDYLDRQQIVDDCENQEAC
YRQPRRGGWPFSNRVQGYGVSDCISEVLKAVLLLQKTAGFPTVIRDRRILDAVDTVLLYQNRNGAWSSYEARRGS
EHLEMLNAAEVFGRIMVEYDYPECTTACVTALSLFRQHWPAYRADEIGDAVDRAAAWIRESQRVDGSWYGSWGIC
FTYATMFALESMAAVGERYENSTTARRGCEFLLSKQREDGGWSESYKSCETMTYHEHPSGSQVVMTAWALIGLLE
ADYPEPEPLRRAAALITDRQRANGEWLQEAIEGVFNKSCMISYPNYKFTFVIKALGMFARRWGE*
Coding >Ophcf2|05302
ATGGCGTCGGCAACAGGACGCGATTCTAATGCTGGAACGCGAAGACGAGCTGCAGGTCCAGAGCCGTCGTTCCCT
GCGAGACCACAACTCGAGGAAAAGACGGACCCAAAGCGTTGGAGATTGAAAGACAACGACAGCTGCCATACCTGG
CACTACTTGCGAGATGATGAGGCTGTAAAAGACTGGCCACAGAGTGATGCGGAAAAGTACTTCCTGGGGCTGCCC
ATGAACCTGCCCGATCTCCCTCCGGCCAAGACACCACTGGAAGCGGCTCGGAATGGCCTCACCTTTTTCGAGAAG
CTGCAGCTGCCATCAGGTCACTGGGCCTGCGAGTACGGAGGCCCCATGTTCCTACTACCGGGCATCGTCATCGCC
TGGTACGTGACGCGAACCACTATACCAGCCGCGCACGCGACCGAGATTCGGAACTACCTGTATGCGAGAGCACAC
CCGGACGATGGCGGCTGGGGGCTTCACATCGAGGGCGAAAGCACCGTCTTCGGAACGTCGCTCAACTACACTGTC
CTCCGACTCCTCGGCGTCGACCCGGACGAGCCGGCCATGATGAAGGCGCGGGCGACGCTGCATAGGCTAGGTGGT
GCCCTCAGAGCTCCTCACTGGGCGAAATTCTGGCTTGCTGTCCTCGGCGTCGTCGATTGGGACATTGTCAACCCC
GTGCCACCGGAGTTGTGGCTGCTGCCGGACTGGGTACCGATAGCGCCGTGGCGATGGTGGATTCATATCCGGCAA
GTCTTCTTGCCCATGGGATACCTGTATTCGAAACGCTGGAGTTGCCGCGAGACGGATGTGACGCGAGCACTCAAG
CGGGAGCTCTTCGTCGAGCCGTACGACGACATTGTCTGGGCGGCGCACCGCAACAGCATCTCTGCCGTCGATAAC
TACCATCCCAAGTCGTGGCTTCTCAACACGGCGAACTGGTTTCTCGTCAACATCTGGAACCCCTACCTCCGGCTC
AACCTCATCAAGGAGAGAGCCGAGGACTGGACCAGCAAGCTAGTGGACATGGAGGACGCCAACACCGACTACGCC
GACCTGGCTCCCGTCAACGCGCCGATGAACACGATCGTATGCTTCGCCCGCGACGGCGCCGGCTCCTACAGCGTC
AGACGACACCTAGAGCGGCTGGAAGAGTTCCTGTGGGTGAAGGACGAGGGCATGCTTTGCAACGGCACCAACGGC
GTCCAATGCTGGGACACGGCCTTTCTCGTCCAGGCCGTCTTCGAAGCCGGTCTACAAGACGACGACCGGTGGCGA
CCCATGCTTCGTCGCGCGCTCGACTACCTCGACCGACAGCAGATCGTTGACGACTGCGAGAATCAGGAAGCGTGC
TACAGGCAGCCTCGCAGGGGCGGCTGGCCCTTTAGCAACCGTGTTCAAGGCTACGGCGTGAGCGACTGCATCTCC
GAGGTGCTCAAAGCAGTCCTCCTCCTCCAAAAGACGGCCGGATTCCCCACCGTCATCCGAGACAGACGCATCCTC
GACGCCGTCGACACGGTCCTCCTCTACCAAAACAGAAACGGAGCCTGGTCTTCGTACGAGGCCCGTCGCGGTAGC
GAGCACCTCGAGATGCTCAACGCAGCCGAGGTCTTTGGCCGCATCATGGTCGAGTACGATTACCCAGAGTGCACG
ACGGCGTGCGTCACGGCCTTGTCCCTCTTCCGTCAGCACTGGCCTGCCTACCGGGCGGATGAGATTGGGGACGCG
GTCGATAGGGCTGCTGCTTGGATTCGTGAGAGCCAGCGCGTGGATGGGAGTTGGTATGGGAGTTGGGGCATCTGC
TTCACCTATGCCACCATGTTTGCCCTCGAGAGCATGGCCGCCGTTGGGGAGCGCTATGAGAACAGTACGACGGCC
AGGCGTGGATGCGAGTTTCTGCTTTCGAAGCAGAGGGAGGACGGCGGTTGGTCCGAGAGCTACAAGTCCTGCGAA
ACAATGACATACCACGAACACCCCTCGGGCTCGCAAGTCGTCATGACCGCCTGGGCCCTCATCGGCCTCCTGGAA
GCCGACTACCCCGAGCCAGAACCTCTCCGTCGCGCGGCAGCCCTCATCACGGACCGGCAGCGAGCCAACGGTGAG
TGGCTACAGGAAGCCATCGAGGGCGTCTTCAACAAGTCGTGTATGATCTCGTACCCGAATTACAAGTTTACCTTT
GTTATCAAGGCGCTGGGTATGTTTGCGCGGCGGTGGGGAGAATGA
Transcript >Ophcf2|05302
ATGGCGTCGGCAACAGGACGCGATTCTAATGCTGGAACGCGAAGACGAGCTGCAGGTCCAGAGCCGTCGTTCCCT
GCGAGACCACAACTCGAGGAAAAGACGGACCCAAAGCGTTGGAGATTGAAAGACAACGACAGCTGCCATACCTGG
CACTACTTGCGAGATGATGAGGCTGTAAAAGACTGGCCACAGAGTGATGCGGAAAAGTACTTCCTGGGGCTGCCC
ATGAACCTGCCCGATCTCCCTCCGGCCAAGACACCACTGGAAGCGGCTCGGAATGGCCTCACCTTTTTCGAGAAG
CTGCAGCTGCCATCAGGTCACTGGGCCTGCGAGTACGGAGGCCCCATGTTCCTACTACCGGGCATCGTCATCGCC
TGGTACGTGACGCGAACCACTATACCAGCCGCGCACGCGACCGAGATTCGGAACTACCTGTATGCGAGAGCACAC
CCGGACGATGGCGGCTGGGGGCTTCACATCGAGGGCGAAAGCACCGTCTTCGGAACGTCGCTCAACTACACTGTC
CTCCGACTCCTCGGCGTCGACCCGGACGAGCCGGCCATGATGAAGGCGCGGGCGACGCTGCATAGGCTAGGTGGT
GCCCTCAGAGCTCCTCACTGGGCGAAATTCTGGCTTGCTGTCCTCGGCGTCGTCGATTGGGACATTGTCAACCCC
GTGCCACCGGAGTTGTGGCTGCTGCCGGACTGGGTACCGATAGCGCCGTGGCGATGGTGGATTCATATCCGGCAA
GTCTTCTTGCCCATGGGATACCTGTATTCGAAACGCTGGAGTTGCCGCGAGACGGATGTGACGCGAGCACTCAAG
CGGGAGCTCTTCGTCGAGCCGTACGACGACATTGTCTGGGCGGCGCACCGCAACAGCATCTCTGCCGTCGATAAC
TACCATCCCAAGTCGTGGCTTCTCAACACGGCGAACTGGTTTCTCGTCAACATCTGGAACCCCTACCTCCGGCTC
AACCTCATCAAGGAGAGAGCCGAGGACTGGACCAGCAAGCTAGTGGACATGGAGGACGCCAACACCGACTACGCC
GACCTGGCTCCCGTCAACGCGCCGATGAACACGATCGTATGCTTCGCCCGCGACGGCGCCGGCTCCTACAGCGTC
AGACGACACCTAGAGCGGCTGGAAGAGTTCCTGTGGGTGAAGGACGAGGGCATGCTTTGCAACGGCACCAACGGC
GTCCAATGCTGGGACACGGCCTTTCTCGTCCAGGCCGTCTTCGAAGCCGGTCTACAAGACGACGACCGGTGGCGA
CCCATGCTTCGTCGCGCGCTCGACTACCTCGACCGACAGCAGATCGTTGACGACTGCGAGAATCAGGAAGCGTGC
TACAGGCAGCCTCGCAGGGGCGGCTGGCCCTTTAGCAACCGTGTTCAAGGCTACGGCGTGAGCGACTGCATCTCC
GAGGTGCTCAAAGCAGTCCTCCTCCTCCAAAAGACGGCCGGATTCCCCACCGTCATCCGAGACAGACGCATCCTC
GACGCCGTCGACACGGTCCTCCTCTACCAAAACAGAAACGGAGCCTGGTCTTCGTACGAGGCCCGTCGCGGTAGC
GAGCACCTCGAGATGCTCAACGCAGCCGAGGTCTTTGGCCGCATCATGGTCGAGTACGATTACCCAGAGTGCACG
ACGGCGTGCGTCACGGCCTTGTCCCTCTTCCGTCAGCACTGGCCTGCCTACCGGGCGGATGAGATTGGGGACGCG
GTCGATAGGGCTGCTGCTTGGATTCGTGAGAGCCAGCGCGTGGATGGGAGTTGGTATGGGAGTTGGGGCATCTGC
TTCACCTATGCCACCATGTTTGCCCTCGAGAGCATGGCCGCCGTTGGGGAGCGCTATGAGAACAGTACGACGGCC
AGGCGTGGATGCGAGTTTCTGCTTTCGAAGCAGAGGGAGGACGGCGGTTGGTCCGAGAGCTACAAGTCCTGCGAA
ACAATGACATACCACGAACACCCCTCGGGCTCGCAAGTCGTCATGACCGCCTGGGCCCTCATCGGCCTCCTGGAA
GCCGACTACCCCGAGCCAGAACCTCTCCGTCGCGCGGCAGCCCTCATCACGGACCGGCAGCGAGCCAACGGTGAG
TGGCTACAGGAAGCCATCGAGGGCGTCTTCAACAAGTCGTGTATGATCTCGTACCCGAATTACAAGTTTACCTTT
GTTATCAAGGCGCTGGGTATGTTTGCGCGGCGGTGGGGAGAATGA
Gene >Ophcf2|05302
ATGGCGTCGGCAACAGGACGCGATTCTAATGCTGGAACGCGAAGACGAGCTGCAGGTCCAGAGCCGTCGTTCCCT
GCGAGACCACAACTCGAGGAAAAGACGGACCCAAAGCGTTGGAGATTGAAAGACAACGACAGCTGCCATACCTGG
CACTACTTGCGAGATGATGAGGCTGTAAAAGACTGGCCACAGAGTGATGCGGAAAAGTACTTCCTGGGGCTGCCC
ATGGTAAAGCTCTCGTCTCGATAGTCTGATGGAGAGAAATACTAATCGCCGCGGCAGAACCTGCCCGATCTCCCT
CCGGCCAAGACACCACTGGAAGCGGCTCGGAATGGCCTCACCTTTTTCGAGAAGCTGCAGCTGCCATCAGGTCAC
TGGGCCTGCGAGTACGGAGGCCCCATGTTCCTACTACCGGGCATCGTCATCGCCTGGTACGTGACGCGAACCACT
ATACCAGCCGCGCACGCGACCGAGATTCGGAACTACCTGTATGCGAGAGCACACCCGGACGATGGCGGCTGGGGG
CTTCACATCGAGGGCGAAAGCACCGTCTTCGGAACGTCGCTCAACTACACTGTCCTCCGACTCCTCGGCGTCGAC
CCGGACGAGCCGGCCATGATGAAGGCGCGGGCGACGCTGCATAGGCTAGGTGGTGCCCTCAGAGCTCCTCACTGG
GCGAAATTCTGGCTTGCTGTCCTCGGCGTCGTCGATTGGGACATTGTCAACCCCGTGCCACCGGAGTTGTGGCTG
CTGCCGGACTGGGTACCGATAGCGCCGTGGCGATGGTGGATTCATATCCGGCAAGTCTTCTTGCCCATGGGATAC
CTGTATTCGAAACGCTGGAGTTGCCGCGAGACGGATGTGACGCGAGCACTCAAGCGGGAGCTCTTCGTCGAGCCG
TACGACGACATTGTCTGGGCGGCGCACCGCAACAGCATCTCTGCCGTCGATAACTACCATCCCAAGTCGTGGCTT
CTCAACACGGCGAACTGGTTTCTCGTCAACATCTGGAACCCCTACCTCCGGCTCAACCTCATCAAGGAGAGAGCC
GAGGACTGGACCAGCAAGCTAGTGGACATGGAGGACGCCAACACCGACTACGCCGACCTGGCTCCCGTCAACGCG
CCGATGAACACGATCGTATGCTTCGCCCGCGACGGCGCCGGCTCCTACAGCGTCAGACGACACCTAGAGCGGCTG
GAAGAGTTCCTGTGGGTGAAGGACGAGGGCATGCTTTGCAACGGCACCAACGGCGTCCAATGCTGGGACACGGCC
TTTCTCGTCCAGGCCGTCTTCGAAGCCGGTCTACAAGACGACGACCGGTGGCGACCCATGCTTCGTCGCGCGCTC
GACTACCTCGACCGACAGCAGATCGTTGACGACTGCGAGAATCAGGAAGCGTGCTACAGGCAGCCTCGCAGGGGC
GGCTGGCCCTTTAGCAACCGTGTTCAAGGCTACGGCGTGAGCGACTGCATCTCCGAGGTGCTCAAAGCAGTCCTC
CTCCTCCAAAAGACGGCCGGATTCCCCACCGTCATCCGAGACAGACGCATCCTCGACGCCGTCGACACGGTCCTC
CTCTACCAAAACAGAAACGGAGCCTGGTCTTCGTACGAGGCCCGTCGCGGTAGCGAGCACCTCGAGATGCTCAAC
GCAGCCGAGGTCTTTGGCCGCATCATGGTCGAGTACGATTACCCAGAGTGCACGACGGCGTGCGTCACGGCCTTG
TCCCTCTTCCGTCAGCACTGGCCTGCCTACCGGGCGGATGAGATTGGGGACGCGGTCGATAGGGCTGCTGCTTGG
ATTCGTGAGAGCCAGCGCGTGGATGGGAGTTGGTATGGGAGTTGGGGCATCTGCTTCACCTATGCCACCATGTTT
GCCCTCGAGAGCATGGCCGCCGTTGGGGAGCGCTATGAGAACAGTACGACGGCCAGGCGTGGATGCGAGTTTCTG
CTTTCGAAGCAGAGGGAGGACGGCGGTTGGTCCGAGAGCTACAAGGTAACACAAAACTCACCACAGTCTCCTTTT
TCGAGGAATCCCACAGCTCACATTCACAACCCAGTCCTGCGAAACAATGACATACCACGAACACCCCTCGGGCTC
GCAAGTCGTCATGACCGCCTGGGCCCTCATCGGCCTCCTGGAAGCCGACTACCCCGAGCCAGAACCTCTCCGTCG
CGCGGCAGCCCTCATCACGGACCGGCAGCGAGCCAACGGTGAGTGGCTACAGGAAGCCATCGAGGGCGTCTTCAA
CAAGTCGTGTATGATCTCGTACCCGAATTACAAGTTTACCTTTGTTATCAAGGCGCTGGGTATGTTTGCGCGGCG
GTGGGGAGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail