Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05299
Gene name
Locationscaffold_05:3190273..3192076
Strand+
Gene length (bp)1803
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 3.0E-40 296 538

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1499 0.247 0.1314 0.0284 0.8743 0.0881 0.0297 0.0173 0.0485 0.0602

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2592
Ophiocordyceps australis 1348a (Ghana) OphauG2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|1721
Ophiocordyceps australis map64 (Brazil) OphauB2|1722
Ophiocordyceps camponoti-floridani Ophcf2|05298
Ophiocordyceps camponoti-floridani Ophcf2|05299 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|359
Ophiocordyceps kimflemingae Ophio5|2368
Ophiocordyceps kimflemingae Ophio5|2369
Ophiocordyceps subramaniannii Hirsu2|2316
Ophiocordyceps subramaniannii Hirsu2|2317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05299
MASPARVACGRSCLSWRGIRRINTAGGNSSIQHIVSRTASGRFPSQPPTSFPRRIPKYLERFRYRLPTVNADGDE
EPGCEMPVSARSECEDKERRRTEPDPTPTSMARPESNLQLKKPKLDVDDEEQDRLAVFELRPAVREPKPLATDSI
DTRPVVTIAWVTDKLYIEDEQRSLVKELRPAAIRDNCVCRSCRDADSGNKLFESSRIPTDMGIEGARATNDGLRV
KLVNDTPGHDETLVPWDKVEVALRRRGAREGFFPRRPSILGQTGMLCWDRDTLQSAVRAIDYEAFMSGNDDDAAL
WDVIIDLCRLGIVFIRGLPTELGAVEEVTRRIANLRETLYGRVFDVMAGALDQASNVAYSSLGLGLHQDLLYLDP
PPQIQVLHCLDNSCPGGDSFFSDSERVARLLWPFVRVSERLSPLATRSVDYHYRGYDYREPPNRYHFYHASRPVL
SHDALTGFTRVWWSPPFQAPSQLADQQLEPWIRAARFFEELISDPEAVFRVRLQPGDCVLFDNRRVLHGRDAFDA
KAKGCQRWLRGAYIAADDFWSRASQMPAKQAEYYRGPEPWSSMMENQDLRHSQWRKRIEQMVMRFDPGVDERMVR
*
Coding >Ophcf2|05299
ATGGCATCGCCCGCGCGGGTCGCCTGTGGCCGGAGCTGCCTCTCGTGGCGTGGCATCAGAAGGATCAACACGGCT
GGCGGCAACAGCAGCATCCAACACATCGTCTCCCGCACAGCTTCGGGCCGTTTCCCCAGCCAGCCGCCGACCTCG
TTCCCTCGACGGATCCCAAAGTATCTGGAGCGGTTCCGGTACCGTCTTCCGACGGTGAATGCGGACGGCGACGAG
GAGCCTGGCTGCGAGATGCCCGTCAGCGCCCGCAGCGAATGTGAGGACAAAGAGCGGAGGAGGACTGAGCCCGAT
CCGACGCCGACTTCCATGGCCAGACCAGAATCGAATCTCCAGCTCAAGAAGCCGAAACTAGATGTTGACGACGAA
GAACAGGACAGGCTCGCCGTCTTCGAGCTGAGGCCAGCTGTGCGCGAGCCAAAGCCCCTGGCGACGGATTCCATC
GACACTCGGCCGGTGGTGACGATAGCTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTC
AAGGAGCTCCGGCCGGCGGCGATCCGCGATAACTGCGTTTGCCGGTCGTGTCGCGACGCCGACTCGGGCAACAAG
CTGTTCGAGTCGTCGCGAATTCCCACAGACATGGGTATCGAAGGCGCGCGAGCCACCAACGACGGGCTCCGAGTG
AAGCTCGTCAACGATACGCCGGGTCACGACGAGACGTTGGTGCCGTGGGACAAGGTCGAGGTGGCGCTTCGTCGA
CGGGGGGCCCGTGAGGGCTTCTTCCCACGACGGCCGTCGATATTGGGCCAGACGGGGATGCTGTGCTGGGATCGG
GACACGTTGCAGAGCGCTGTGCGGGCCATCGACTACGAAGCCTTCATGTCTGGCAATGACGATGATGCCGCCCTC
TGGGACGTCATCATCGACCTCTGCCGGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGAGCTCGGTGCCGTC
GAGGAGGTGACGAGGCGGATTGCGAACCTGCGCGAGACGCTTTATGGACGCGTCTTCGATGTCATGGCCGGAGCG
TTGGACCAGGCCAGCAACGTGGCCTACTCTTCGCTAGGGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCG
CCGCCCCAGATCCAGGTGCTTCACTGCCTCGATAACTCTTGTCCCGGCGGCGACTCTTTCTTCTCCGACTCGGAG
CGCGTAGCGCGTCTGCTATGGCCGTTTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTTGAC
TACCATTACCGCGGCTACGACTACCGCGAACCTCCCAACCGTTACCATTTTTACCACGCCAGCCGGCCGGTCCTG
TCCCACGACGCCCTTACGGGTTTCACGCGCGTCTGGTGGAGCCCGCCCTTTCAGGCGCCGTCGCAACTAGCAGAC
CAGCAGCTGGAGCCGTGGATCCGGGCAGCCCGTTTCTTCGAAGAGCTCATCTCGGACCCAGAGGCCGTCTTCCGC
GTGCGTCTCCAGCCTGGAGACTGCGTTCTCTTCGACAACCGCCGAGTGCTGCACGGGCGGGACGCGTTCGACGCC
AAAGCGAAGGGTTGTCAACGCTGGCTTAGGGGCGCGTACATTGCTGCCGATGACTTTTGGAGCAGGGCTTCGCAG
ATGCCGGCTAAGCAGGCTGAGTATTATCGAGGGCCGGAGCCCTGGTCTAGCATGATGGAGAATCAGGACTTGAGG
CATTCGCAGTGGAGGAAAAGGATTGAGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGG
TAG
Transcript >Ophcf2|05299
ATGGCATCGCCCGCGCGGGTCGCCTGTGGCCGGAGCTGCCTCTCGTGGCGTGGCATCAGAAGGATCAACACGGCT
GGCGGCAACAGCAGCATCCAACACATCGTCTCCCGCACAGCTTCGGGCCGTTTCCCCAGCCAGCCGCCGACCTCG
TTCCCTCGACGGATCCCAAAGTATCTGGAGCGGTTCCGGTACCGTCTTCCGACGGTGAATGCGGACGGCGACGAG
GAGCCTGGCTGCGAGATGCCCGTCAGCGCCCGCAGCGAATGTGAGGACAAAGAGCGGAGGAGGACTGAGCCCGAT
CCGACGCCGACTTCCATGGCCAGACCAGAATCGAATCTCCAGCTCAAGAAGCCGAAACTAGATGTTGACGACGAA
GAACAGGACAGGCTCGCCGTCTTCGAGCTGAGGCCAGCTGTGCGCGAGCCAAAGCCCCTGGCGACGGATTCCATC
GACACTCGGCCGGTGGTGACGATAGCTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTC
AAGGAGCTCCGGCCGGCGGCGATCCGCGATAACTGCGTTTGCCGGTCGTGTCGCGACGCCGACTCGGGCAACAAG
CTGTTCGAGTCGTCGCGAATTCCCACAGACATGGGTATCGAAGGCGCGCGAGCCACCAACGACGGGCTCCGAGTG
AAGCTCGTCAACGATACGCCGGGTCACGACGAGACGTTGGTGCCGTGGGACAAGGTCGAGGTGGCGCTTCGTCGA
CGGGGGGCCCGTGAGGGCTTCTTCCCACGACGGCCGTCGATATTGGGCCAGACGGGGATGCTGTGCTGGGATCGG
GACACGTTGCAGAGCGCTGTGCGGGCCATCGACTACGAAGCCTTCATGTCTGGCAATGACGATGATGCCGCCCTC
TGGGACGTCATCATCGACCTCTGCCGGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGAGCTCGGTGCCGTC
GAGGAGGTGACGAGGCGGATTGCGAACCTGCGCGAGACGCTTTATGGACGCGTCTTCGATGTCATGGCCGGAGCG
TTGGACCAGGCCAGCAACGTGGCCTACTCTTCGCTAGGGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCG
CCGCCCCAGATCCAGGTGCTTCACTGCCTCGATAACTCTTGTCCCGGCGGCGACTCTTTCTTCTCCGACTCGGAG
CGCGTAGCGCGTCTGCTATGGCCGTTTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTTGAC
TACCATTACCGCGGCTACGACTACCGCGAACCTCCCAACCGTTACCATTTTTACCACGCCAGCCGGCCGGTCCTG
TCCCACGACGCCCTTACGGGTTTCACGCGCGTCTGGTGGAGCCCGCCCTTTCAGGCGCCGTCGCAACTAGCAGAC
CAGCAGCTGGAGCCGTGGATCCGGGCAGCCCGTTTCTTCGAAGAGCTCATCTCGGACCCAGAGGCCGTCTTCCGC
GTGCGTCTCCAGCCTGGAGACTGCGTTCTCTTCGACAACCGCCGAGTGCTGCACGGGCGGGACGCGTTCGACGCC
AAAGCGAAGGGTTGTCAACGCTGGCTTAGGGGCGCGTACATTGCTGCCGATGACTTTTGGAGCAGGGCTTCGCAG
ATGCCGGCTAAGCAGGCTGAGTATTATCGAGGGCCGGAGCCCTGGTCTAGCATGATGGAGAATCAGGACTTGAGG
CATTCGCAGTGGAGGAAAAGGATTGAGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGG
TAG
Gene >Ophcf2|05299
ATGGCATCGCCCGCGCGGGTCGCCTGTGGCCGGAGCTGCCTCTCGTGGCGTGGCATCAGAAGGATCAACACGGCT
GGCGGCAACAGCAGCATCCAACACATCGTCTCCCGCACAGCTTCGGGCCGTTTCCCCAGCCAGCCGCCGACCTCG
TTCCCTCGACGGATCCCAAAGTATCTGGAGCGGTTCCGGTACCGTCTTCCGACGGTGAATGCGGACGGCGACGAG
GAGCCTGGCTGCGAGATGCCCGTCAGCGCCCGCAGCGAATGTGAGGACAAAGAGCGGAGGAGGACTGAGCCCGAT
CCGACGCCGACTTCCATGGCCAGACCAGAATCGAATCTCCAGCTCAAGAAGCCGAAACTAGATGTTGACGACGAA
GAACAGGACAGGCTCGCCGTCTTCGAGCTGAGGCCAGCTGTGCGCGAGCCAAAGCCCCTGGCGACGGATTCCATC
GACACTCGGCCGGTGGTGACGATAGCTTGGGTGACGGACAAGCTCTATATCGAGGACGAGCAGCGGTCGCTGGTC
AAGGAGCTCCGGCCGGCGGCGATCCGCGATAACTGCGTTTGCCGGTCGTGTCGCGACGCCGACTCGGGCAACAAG
CTGTTCGAGTCGTCGCGAATTCCCACAGACATGGGTATCGAAGGCGCGCGAGCCACCAACGACGGGCTCCGAGTG
AAGCTCGTCAACGATACGCCGGGTCACGACGAGACGTTGGTGCCGTGGGACAAGGTCGAGGTGGCGCTTCGTCGA
CGGGGGGCCCGTGAGGGCTTCTTCCCACGACGGCCGTCGATATTGGGCCAGACGGGGATGCTGTGCTGGGATCGG
GACACGTTGCAGAGCGCTGTGCGGGCCATCGACTACGAAGCCTTCATGTCTGGCAATGACGATGATGCCGCCCTC
TGGGACGTCATCATCGACCTCTGCCGGTTGGGCATCGTCTTCATCCGCGGCCTTCCCACCGAGCTCGGTGCCGTC
GAGGAGGTGACGAGGCGGATTGCGAACCTGCGCGAGACGCTTTATGGACGCGTCTTCGATGTCATGGCCGGAGCG
TTGGACCAGGCCAGCAACGTGGCCTACTCTTCGCTAGGGCTGGGCCTGCACCAGGACCTGCTATATCTCGATCCG
CCGCCCCAGATCCAGGTGCTTCACTGCCTCGATAACTCTTGTCCCGGCGGCGACTCTTTCTTCTCCGACTCGGAG
CGCGTAGCGCGTCTGCTATGGCCGTTTGTGCGCGTCAGCGAGCGTCTCAGTCCCCTGGCGACTCGATCCGTTGAC
TACCATTACCGCGGCTACGACTACCGCGAACCTCCCAACCGTTACCATTTTTACCACGCCAGCCGGCCGGTCCTG
TCCCACGACGCCCTTACGGGTTTCACGCGCGTCTGGTGGAGCCCGCCCTTTCAGGCGCCGTCGCAACTAGCAGAC
CAGCAGCTGGAGCCGTGGATCCGGGCAGCCCGTTTCTTCGAAGAGCTCATCTCGGACCCAGAGGCCGTCTTCCGC
GTGCGTCTCCAGCCTGGAGACTGCGTTCTCTTCGACAACCGCCGAGTGCTGCACGGGCGGGACGCGTTCGACGCC
AAAGCGAAGGGTTGTCAACGCTGGCTTAGGGGCGCGTACATTGCTGCCGATGACTTTTGGAGCAGGGCTTCGCAG
ATGCCGGCTAAGCAGGCTGAGTATTATCGAGGGCCGGAGCCCTGGTCTAGCATGATGGAGAATCAGGACTTGAGG
CATTCGCAGTGGAGGAAAAGGATTGAGCAGATGGTGATGCGGTTTGATCCGGGGGTTGATGAGAGGATGGTTCGG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail