Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05298
Gene name
Locationscaffold_05:3188124..3190061
Strand+
Gene length (bp)1937
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01974 tRNA_int_endo tRNA intron endonuclease, catalytic C-terminal domain 2.0E-18 389 475

GO

GO Term Description Terminal node
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0000213 tRNA-intron endonuclease activity Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016892 endoribonuclease activity, producing 3'-phosphomonoesters No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0004519 endonuclease activity No
GO:0043170 macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0004549 tRNA-specific ribonuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0006399 tRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0016894 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters No
GO:0071704 organic substance metabolic process No
GO:0004521 endoribonuclease activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0004518 nuclease activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0004540 ribonuclease activity No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034470 ncRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0008380 RNA splicing No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4574 0.4955 0.0756 0.0067 0.3562 0.1173 0.4207 0.1158 0.243 0.1615

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2592
Ophiocordyceps australis 1348a (Ghana) OphauG2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|1721
Ophiocordyceps australis map64 (Brazil) OphauB2|1722
Ophiocordyceps camponoti-floridani Ophcf2|05298 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05299
Ophiocordyceps camponoti-rufipedis Ophun1|359
Ophiocordyceps kimflemingae Ophio5|2368
Ophiocordyceps kimflemingae Ophio5|2369
Ophiocordyceps subramaniannii Hirsu2|2316
Ophiocordyceps subramaniannii Hirsu2|2317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05298
MYLPPCLAWVSSTAAQLTSPWCSPDMAEVNASSNVRASLPRRGPSIHQIYSLPAPFRTFPLPTFYPDNPLSLLHV
ASAWLSQLFRPPPAEPAVIHSGVWSEESTSVHVKDEKSMRALWEQGFYGKGNLSRSEPNWMKRQRVVRGLQDAHV
SELLTLQRRQERAEAKWERARLEQEAIRNTKLQEARQEAARRRAESKNSSHAAPVGPLELLSLPNSHLTMSLTGP
VPERGPEVVGEARHEKQNGTFAVSPAAADEMTRENQLVSKPAECSETSSDSTSVKRQKSVRFSPKVESTTFQLSD
PPNPNHASTPNSSSPIDDAEEELVNQEHLQLMPEEAFFLCFGLGALRVTEPDSDDALSTRQMLKRFRQYSYVPPR
IEPDEPELGADDAFLVHYAVYHHFRSLGWVPRAGIKFGVDWLLYARGPVFDHAEFGVIVIPSYSNPWWERSGIGK
SWAWLHGVVRVLSHVMKSLVLVYVDVPPTPRFEEALAVGIGEAMKLYRVREVTVKRWSSNRNR*
Coding >Ophcf2|05298
ATGTACCTACCGCCGTGTCTCGCCTGGGTCAGTTCTACAGCTGCCCAGCTCACGTCACCATGGTGCTCTCCCGAC
ATGGCTGAGGTCAATGCTTCGTCCAACGTGAGAGCTTCGCTTCCGAGGCGAGGCCCTTCCATCCATCAGATATAC
TCGCTGCCCGCCCCCTTCCGCACCTTTCCTCTCCCGACCTTCTACCCCGACAACCCTCTGTCGCTGTTGCACGTC
GCCTCGGCATGGCTGAGCCAGCTCTTTCGACCGCCTCCCGCCGAGCCAGCCGTCATCCACTCCGGCGTGTGGTCT
GAGGAGTCCACTTCTGTCCATGTCAAGGATGAAAAGTCTATGCGCGCCCTCTGGGAGCAGGGCTTCTACGGTAAA
GGCAACCTGAGCCGTAGCGAGCCCAACTGGATGAAGCGGCAGCGCGTTGTAAGAGGGCTGCAAGATGCTCATGTC
AGTGAGCTTTTGACGTTGCAGAGGCGTCAGGAACGTGCAGAGGCAAAGTGGGAGCGGGCGAGGCTGGAACAGGAA
GCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCGAGCTGAATCAAAAAATTCGTCT
CATGCGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCGCATCTCACCATGTCACTGACCGGGCCG
GTCCCAGAGAGAGGGCCTGAAGTCGTCGGCGAAGCCAGACATGAGAAGCAAAACGGAACCTTTGCCGTCAGTCCC
GCAGCCGCCGACGAGATGACACGCGAGAATCAGCTCGTCAGCAAGCCCGCCGAGTGCTCCGAAACCTCGAGCGAT
TCTACTTCGGTGAAACGACAGAAGAGCGTCCGATTCTCTCCAAAGGTAGAGTCGACGACGTTCCAGTTGTCCGAT
CCTCCGAATCCCAACCACGCGTCGACCCCCAACAGCAGCAGCCCCATTGACGACGCGGAGGAGGAACTGGTCAAT
CAAGAGCACCTACAGCTGATGCCCGAGGAGGCCTTCTTCCTATGCTTCGGGCTGGGGGCTCTCCGTGTTACGGAG
CCCGACTCTGACGACGCACTGTCGACGAGGCAAATGTTGAAACGCTTCCGGCAGTACTCGTATGTCCCGCCGCGG
ATCGAACCAGACGAGCCGGAGCTGGGGGCGGACGACGCATTCCTGGTGCATTACGCCGTCTACCACCACTTCCGG
TCACTCGGCTGGGTGCCGCGGGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGTATGCCAGGGGGCCCGTCTTT
GACCACGCCGAGTTTGGCGTCATCGTCATCCCGTCGTACTCGAACCCGTGGTGGGAGAGGTCGGGCATCGGCAAG
TCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAC
GTGCCGCCGACGCCGAGGTTTGAGGAGGCGCTGGCGGTGGGCATCGGAGAGGCGATGAAACTGTACAGGGTGAGG
GAGGTGACGGTGAAGCGGTGGTCGAGCAATCGAAATCGGTGA
Transcript >Ophcf2|05298
ATGTACCTACCGCCGTGTCTCGCCTGGGTCAGTTCTACAGCTGCCCAGCTCACGTCACCATGGTGCTCTCCCGAC
ATGGCTGAGGTCAATGCTTCGTCCAACGTGAGAGCTTCGCTTCCGAGGCGAGGCCCTTCCATCCATCAGATATAC
TCGCTGCCCGCCCCCTTCCGCACCTTTCCTCTCCCGACCTTCTACCCCGACAACCCTCTGTCGCTGTTGCACGTC
GCCTCGGCATGGCTGAGCCAGCTCTTTCGACCGCCTCCCGCCGAGCCAGCCGTCATCCACTCCGGCGTGTGGTCT
GAGGAGTCCACTTCTGTCCATGTCAAGGATGAAAAGTCTATGCGCGCCCTCTGGGAGCAGGGCTTCTACGGTAAA
GGCAACCTGAGCCGTAGCGAGCCCAACTGGATGAAGCGGCAGCGCGTTGTAAGAGGGCTGCAAGATGCTCATGTC
AGTGAGCTTTTGACGTTGCAGAGGCGTCAGGAACGTGCAGAGGCAAAGTGGGAGCGGGCGAGGCTGGAACAGGAA
GCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCGAGCTGAATCAAAAAATTCGTCT
CATGCGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCGCATCTCACCATGTCACTGACCGGGCCG
GTCCCAGAGAGAGGGCCTGAAGTCGTCGGCGAAGCCAGACATGAGAAGCAAAACGGAACCTTTGCCGTCAGTCCC
GCAGCCGCCGACGAGATGACACGCGAGAATCAGCTCGTCAGCAAGCCCGCCGAGTGCTCCGAAACCTCGAGCGAT
TCTACTTCGGTGAAACGACAGAAGAGCGTCCGATTCTCTCCAAAGGTAGAGTCGACGACGTTCCAGTTGTCCGAT
CCTCCGAATCCCAACCACGCGTCGACCCCCAACAGCAGCAGCCCCATTGACGACGCGGAGGAGGAACTGGTCAAT
CAAGAGCACCTACAGCTGATGCCCGAGGAGGCCTTCTTCCTATGCTTCGGGCTGGGGGCTCTCCGTGTTACGGAG
CCCGACTCTGACGACGCACTGTCGACGAGGCAAATGTTGAAACGCTTCCGGCAGTACTCGTATGTCCCGCCGCGG
ATCGAACCAGACGAGCCGGAGCTGGGGGCGGACGACGCATTCCTGGTGCATTACGCCGTCTACCACCACTTCCGG
TCACTCGGCTGGGTGCCGCGGGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGTATGCCAGGGGGCCCGTCTTT
GACCACGCCGAGTTTGGCGTCATCGTCATCCCGTCGTACTCGAACCCGTGGTGGGAGAGGTCGGGCATCGGCAAG
TCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAC
GTGCCGCCGACGCCGAGGTTTGAGGAGGCGCTGGCGGTGGGCATCGGAGAGGCGATGAAACTGTACAGGGTGAGG
GAGGTGACGGTGAAGCGGTGGTCGAGCAATCGAAATCGGTGA
Gene >Ophcf2|05298
ATGTACCTACGTACTCGGGTCAGACAGTGATATTAGCACAGTACTTCCGTCAAGTAGCTCTCGTGCAAAAATTTT
CGCAGCCCATATCCATCACCCACTCCGTCAGCCAACAACCGAGATACACACATACATACAGCTGCTATCTTACCG
CCCTCCAGTCGTCTCGGGACAGCGCCGTGTCTCGCCTGGGTCAGTTCTACAGCTGCCCAGCTCACGTAAGTATCT
GCGTCTTTCACTCTCCTCCCGCAACTACCTGCGAGGTGCGATTCCGCGCCTCTTCCCTCTCAAACCCAGCTGCTA
TGATGATACAACACCCGAGTGCTCAGAGGAACCATTCACTTGGCCTCTGTGAGAGCCAACAAATTATAGACTACA
ACGGTATCTGATGTAGCTTGAGAACCTTCAACTTGCTTGCCGGAACTCGTCGGCCGCACGCTGACTTCTCCAGGT
CACCATGGTGCTCTCCCGACATGGCTGAGGTCAATGCTTCGTCCAACGTGAGAGCTTCGCTTCCGAGGCGAGGCC
CTTCCATCCATCAGATATACTCGCTGCCCGCCCCCTTCCGCACCTTTCCTCTCCCGACCTTCTACCCCGACAACC
CTCTGTCGCTGTTGCACGTCGCCTCGGCATGGCTGAGCCAGCTCTTTCGACCGCCTCCCGCCGAGCCAGCCGTCA
TCCACTCCGGCGTGTGGTCTGAGGAGTCCACTTCTGTCCATGTCAAGGATGAAAAGTCTATGCGCGCCCTCTGGG
AGCAGGGCTTCTACGGTAAAGGCAACCTGAGCCGTAGCGAGCCCAACTGGATGAAGCGGCAGCGCGTTGTAAGAG
GGCTGCAAGATGCTCATGTCAGTGAGCTTTTGACGTTGCAGAGGCGTCAGGAACGTGCAGAGGCAAAGTGGGAGC
GGGCGAGGCTGGAACAGGAAGCCATTCGAAATACGAAGCTGCAAGAGGCGCGTCAGGAAGCTGCTCGTCGTCGAG
CTGAATCAAAAAATTCGTCTCATGCGGCGCCCGTCGGGCCGCTTGAGCTCTTGTCGCTGCCAAACTCGCATCTCA
CCATGTCACTGACCGGGCCGGTCCCAGAGAGAGGGCCTGAAGTCGTCGGCGAAGCCAGACATGAGAAGCAAAACG
GAACCTTTGCCGTCAGTCCCGCAGCCGCCGACGAGATGACACGCGAGAATCAGCTCGTCAGCAAGCCCGCCGAGT
GCTCCGAAACCTCGAGCGATTCTACTTCGGTGAAACGACAGAAGAGCGTCCGATTCTCTCCAAAGGTAGAGTCGA
CGACGTTCCAGTTGTCCGATCCTCCGAATCCCAACCACGCGTCGACCCCCAACAGCAGCAGCCCCATTGACGACG
CGGAGGAGGAACTGGTCAATCAAGAGCACCTACAGCTGATGCCCGAGGAGGCCTTCTTCCTATGCTTCGGGCTGG
GGGCTCTCCGTGTTACGGAGCCCGACTCTGACGACGCACTGTCGACGAGGCAAATGTTGAAACGCTTCCGGCAGT
ACTCGTATGTCCCGCCGCGGATCGAACCAGACGAGCCGGAGCTGGGGGCGGACGACGCATTCCTGGTGCATTACG
CCGTCTACCACCACTTCCGGTCACTCGGCTGGGTGCCGCGGGCTGGCATCAAATTCGGGGTGGACTGGCTGCTGT
ATGCCAGGGGGCCCGTCTTTGACCACGCCGAGTTTGGCGTCATCGTCATCCCGTCGTACTCGAACCCGTGGTGGG
AGAGGTCGGGCATCGGCAAGTCGTGGGCATGGCTTCACGGCGTTGTACGAGTATTGTCACACGTGATGAAGAGCC
TGGTGCTCGTGTACGTCGACGTGCCGCCGACGCCGAGGTTTGAGGAGGCGCTGGCGGTGGGCATCGGAGAGGCGA
TGAAACTGTACAGGGTGAGGGAGGTGACGGTGAAGCGGTGGTCGAGCAATCGAAATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail