Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05289
Gene name
Locationscaffold_05:3153533..3159062
Strand-
Gene length (bp)5529
Transcript length (bp)5241
Coding sequence length (bp)5241
Protein length (aa) 1747

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08429 PLU-1 PLU-1-like protein 2.3E-109 942 1286
PF02373 JmjC JmjC domain, hydroxylase 1.7E-43 641 757
PF01388 ARID ARID/BRIGHT DNA binding domain 6.8E-20 176 261
PF00628 PHD PHD-finger 5.0E-10 469 514
PF00628 PHD PHD-finger 1.4E-07 1336 1381
PF02375 JmjN jmjN domain 2.0E-14 108 141
PF02928 zf-C5HC2 C5HC2 zinc finger 6.8E-11 869 923

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3482 0.9077 0.0393 0.0277 0.0514 0.0187 0.0353 0.0084 0.0291 0.0003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4491
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3084
Ophiocordyceps australis map64 (Brazil) OphauB2|1735
Ophiocordyceps camponoti-floridani Ophcf2|05289 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|375
Ophiocordyceps kimflemingae Ophio5|8285
Ophiocordyceps subramaniannii Hirsu2|9370

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05289
MAAGHTTTTSKAAAAAAAAANTSSADASTRSSPIPGGGAPSNHTPSSNSRPKNKVNTNGYHPPNPQAPLSAMVSP
ALDLASVERRGQPTAVREPHRKKTRPHGISEAPTYCPTIDEWRDPLEYLKSIAPEASQYGICKIIPPDSWNPDFA
INTERFHFRTRKQELNSVEGSTRANLTYLESLFKYHRQQGLNLHRMPFVDKKPLDLYRLKKAVESRGGFDKVCKL
KKWAEIGRDLGYSGKIMSSLSTSLKNSYSRWLVPYEDYLRLAKPGVHQQLEQEYGGPLTPSPVPTPIKPSNGNTP
SSVKPDSPARQASDALQAGLDKEPDVDTPMVDTSPAPTVSGGFTAINTNGFTAVNSANRSANTDGKRFTPDPKRP
DSPTSSTKGAPEGRSSGLGAAATLKRTLSSCGSSSDSTKKDADGVKEEGEPSSRRSKRLKKDAVPTVAGSHMTLF
RPSVPRIPREEAAGSTEKCENCGRGDDAGSLLVCESCDNVYHGPCLDPPLKRKPEAEWNCPRCLVGDGQFGFEEG
GLYSLRQFQQKANDFKQGYFEKKMPFDHALNCHRPVTEQDVETEFWRLVADLEETVEVEYGADIHCTTHGSGFPT
VEKNPNNPYATDPWNLNVLPFHAESLFRHIKSDISGMTVPWVYVGMIFSTFCWHNEDHYAYSANYQHFGATKTWY
GIPGEDAEKFESAMKEAVPELFETQPDLLFQLVTLLTPEQLKKAGVRVYALDQRAGQFVITFPQAYHAGFNHGFN
FNEAVNFAPCDWEPFGQAGVERLQLFRRQPCFSHDELLWTAAEGSAASGLTIQTAKWLAPALDRIQKREAAQRDM
FVAKHAEASPHQCRLTGEGDGDGSCPMTFAIEDKDVTDEDEQCCSHCKAFAYLSRFKCQRSGKVLCILHAGSHAC
CDQTEQQRYLGDEHVLYHRKADDVIKATCDKVVQKARTPELWEEKYTTILDDEATPSLKTLRSLLNEGERIPYDL
PSLPVLKGFVDRCNDWVDEATNYIVRKQQVRRKSDKVLQGGARKSSQEQKERESRNVTNIHRLLREADHIGFDCP
EIGQLQERATAIKTFQMSASRVLENTASTAVETIEELLEQGRSFNVDMPEVDGLSRILEQMRWNDKAREDRRTLL
SLQYVQEMIDEGKRLEIPSYNDHLKYFRDQLQAGEAWERKAKELIDAETVHYPQLEALSSQVQVNLLPVSIETLN
MVDQILHKQREAHRQILDITERCRSDDFRQRPRYAEVVEISKKLEDLNSKPNGTLDLENERKRHEDWMRKGKKLF
GKSNAPLHILKSHLEYVLERNMDCFDVEKDTPRLPGEPISREATPETGPGRWEDPGPRQVFCICRKIEAGMMIEC
ELCHEWYHYKCLKIARGKVKEDDKYTCPICDYRMKIPRDAARPKLEDLVTLAKEMPMLPFQPEEESVLTRIIDNA
QTFRDHIARYCNQLLSTKAEAETQRFYLRKLEGAEVLLAYETNFFRQELHKWCPVAPDAPPIMDKSNSTRKPRPT
KLQKMLAEYGVDNPDDLPEHARGKANSLRRKAANAEAAAAAAAAAAASSVAAAPGVTMPPSNSPAYGSSAFFPAR
PSPSSGAGPSPPGTGRGPASATSQNGGKADDANVDPGLHAGFLGASVPQLVADNSVLSLDERLLRGEDGKSLDML
RRSADDRHQAMPIWDDDVWRHNRGSMSDRGGSLTPAEMELMKHDEGSVDQMFKEMTNVVDEEDEGKKKETAGATG
PVTAESLESERNGLDALLDGE*
Coding >Ophcf2|05289
ATGGCGGCGGGACATACGACCACGACGAGCAAGGCCGCCGCCGCCGCCGCCGCCGCTGCCAATACGAGCAGCGCT
GATGCCAGCACTCGCAGCTCGCCCATCCCCGGCGGCGGCGCTCCGTCAAACCACACGCCCTCTTCGAACTCGAGA
CCCAAAAACAAGGTCAATACCAACGGCTACCATCCCCCGAATCCGCAGGCCCCCCTCAGCGCCATGGTCAGTCCC
GCCCTGGATCTGGCCTCGGTTGAGCGACGCGGACAGCCCACGGCGGTGCGCGAGCCTCATAGAAAGAAGACTCGA
CCCCACGGCATATCCGAGGCTCCGACCTACTGCCCGACGATCGACGAGTGGCGGGACCCGCTCGAGTACCTCAAA
TCCATCGCCCCCGAGGCCTCGCAGTACGGCATCTGCAAAATTATACCCCCTGACTCGTGGAATCCCGACTTCGCC
ATCAACACCGAGAGGTTCCACTTCCGCACTCGCAAGCAGGAACTCAACTCGGTCGAAGGCAGCACCCGTGCGAAC
CTGACGTACCTTGAAAGCCTTTTCAAGTACCACAGGCAGCAAGGCTTAAATTTACACCGCATGCCCTTTGTCGAT
AAGAAGCCGCTCGATCTGTATCGCCTGAAAAAGGCGGTAGAGTCCCGCGGCGGCTTCGACAAGGTCTGCAAGCTT
AAGAAATGGGCCGAGATCGGTCGTGATCTTGGTTATAGCGGCAAGATAATGTCCTCGCTGTCGACGTCTCTCAAG
AACTCGTACTCGCGCTGGCTCGTCCCTTATGAGGACTACCTGCGCCTCGCCAAGCCGGGTGTGCATCAGCAGCTT
GAGCAGGAGTACGGCGGGCCACTCACTCCCAGTCCCGTGCCGACTCCCATCAAGCCGTCTAACGGCAACACACCT
TCGAGCGTCAAGCCAGACTCTCCTGCTCGGCAGGCGTCCGATGCCCTGCAAGCCGGCCTCGACAAGGAACCAGAC
GTCGACACGCCAATGGTAGACACCTCGCCGGCCCCCACCGTCTCGGGAGGTTTCACGGCTATCAACACCAACGGC
TTCACCGCCGTCAATTCGGCCAATCGGTCCGCCAACACCGACGGCAAAAGGTTCACCCCGGATCCTAAGCGGCCC
GACAGCCCCACGTCATCGACCAAGGGCGCGCCCGAGGGGCGGTCGTCGGGCTTGGGTGCCGCCGCGACGCTGAAA
CGGACCCTCAGCAGCTGTGGCAGCTCGTCCGACTCAACCAAGAAGGATGCCGACGGTGTAAAGGAAGAGGGCGAG
CCGAGCAGCCGTCGTAGTAAGCGGCTGAAGAAGGATGCCGTCCCGACCGTGGCGGGCTCGCACATGACGCTTTTC
CGCCCTTCGGTGCCCCGTATTCCTCGCGAGGAGGCGGCGGGAAGTACGGAAAAATGCGAAAACTGCGGCAGAGGT
GACGACGCCGGCTCGCTGCTCGTGTGCGAGTCGTGCGATAATGTCTATCACGGCCCCTGTCTCGACCCTCCGCTG
AAGCGCAAACCAGAGGCCGAATGGAACTGTCCACGCTGCCTCGTCGGCGACGGCCAGTTCGGGTTTGAGGAGGGC
GGGCTGTACTCGCTGCGCCAGTTCCAGCAAAAGGCAAATGACTTCAAGCAGGGCTACTTTGAGAAGAAGATGCCT
TTCGATCACGCCCTCAACTGCCACCGCCCCGTCACCGAACAGGACGTCGAGACCGAATTCTGGCGTCTGGTCGCC
GACCTGGAGGAGACGGTCGAGGTCGAGTACGGCGCCGATATTCATTGCACCACGCACGGCTCCGGCTTCCCGACC
GTGGAGAAGAATCCAAACAATCCTTACGCGACGGACCCTTGGAACCTCAATGTGCTGCCCTTCCATGCCGAGAGC
CTCTTTCGACATATCAAGTCAGACATCTCGGGTATGACGGTGCCCTGGGTGTATGTAGGCATGATCTTCTCCACG
TTTTGCTGGCACAACGAGGACCACTACGCCTATTCGGCCAACTACCAGCACTTCGGCGCCACCAAGACGTGGTAC
GGGATTCCTGGGGAAGACGCCGAGAAGTTCGAGTCCGCCATGAAGGAGGCCGTCCCCGAGCTCTTTGAGACGCAG
CCGGATCTGCTGTTTCAGCTCGTGACGCTTCTCACGCCCGAGCAGCTGAAGAAAGCAGGCGTACGCGTCTACGCC
CTTGATCAGCGAGCTGGCCAGTTCGTCATAACCTTTCCCCAGGCCTATCACGCCGGCTTCAACCACGGCTTCAAC
TTCAACGAGGCCGTTAACTTCGCCCCCTGCGACTGGGAGCCTTTCGGGCAGGCCGGCGTTGAGAGGCTGCAGCTG
TTCCGGCGACAGCCGTGCTTCTCGCACGACGAGCTGCTGTGGACTGCCGCCGAGGGCAGCGCGGCCTCTGGTCTC
ACCATACAGACGGCCAAGTGGCTCGCTCCGGCCCTTGACCGGATCCAGAAGCGCGAGGCGGCGCAGCGGGACATG
TTTGTCGCCAAACACGCCGAGGCCTCGCCTCATCAGTGTCGTTTGACGGGCGAAGGCGACGGAGACGGCAGCTGC
CCGATGACCTTTGCCATCGAGGACAAGGACGTGACAGATGAAGATGAGCAGTGCTGCAGCCATTGCAAGGCTTTT
GCTTACCTGTCCCGCTTCAAGTGCCAGCGGTCCGGCAAGGTGCTCTGCATCCTGCACGCCGGTTCCCATGCATGC
TGCGACCAGACGGAGCAGCAGAGGTACCTCGGGGACGAGCATGTCCTCTATCACCGAAAGGCCGACGACGTCATC
AAGGCAACGTGCGACAAGGTCGTGCAAAAGGCCCGCACCCCGGAGCTTTGGGAGGAAAAGTACACGACCATTCTC
GACGACGAGGCTACGCCGTCGCTCAAGACGTTGAGGAGCCTGCTCAATGAGGGCGAGCGCATCCCCTACGACCTC
CCGTCTCTCCCGGTCCTCAAAGGATTCGTCGACCGGTGCAACGACTGGGTCGACGAGGCCACCAACTACATCGTC
CGCAAGCAGCAGGTGCGCAGGAAGAGTGACAAGGTCTTGCAGGGCGGCGCGCGCAAGTCGAGCCAGGAGCAAAAG
GAGCGTGAGTCGCGCAACGTAACCAACATACATCGCCTACTGAGAGAGGCCGACCACATCGGCTTCGACTGTCCC
GAAATCGGCCAGCTACAGGAGCGGGCTACCGCCATCAAAACGTTTCAGATGAGCGCCTCTCGGGTGCTGGAGAAT
ACGGCATCGACGGCGGTGGAGACGATCGAGGAGCTGCTCGAGCAAGGGCGGAGTTTCAACGTGGACATGCCCGAG
GTCGACGGCCTGTCGCGGATTCTCGAGCAGATGCGCTGGAACGACAAGGCTCGCGAAGATCGCAGGACCTTGCTG
TCGCTGCAGTACGTTCAGGAGATGATTGACGAGGGCAAGCGGCTCGAGATACCCAGCTACAACGACCACCTCAAG
TATTTCCGCGACCAGCTGCAGGCGGGCGAGGCGTGGGAGCGCAAGGCCAAGGAGCTCATCGACGCCGAGACGGTG
CACTACCCTCAGCTCGAGGCGCTTTCCAGCCAGGTGCAAGTCAACCTGCTGCCGGTATCGATCGAGACGCTCAAC
ATGGTTGATCAGATCCTTCACAAGCAGCGAGAGGCACATCGACAGATCCTGGACATTACCGAGAGGTGTCGCAGC
GATGACTTCCGCCAGCGTCCGCGGTACGCCGAGGTGGTTGAGATTTCCAAGAAGCTCGAGGACCTCAACTCGAAA
CCCAACGGTACGCTGGATCTTGAGAACGAGCGCAAGCGGCACGAGGACTGGATGCGCAAGGGGAAGAAGCTGTTT
GGAAAGTCCAACGCGCCGCTTCACATACTCAAGAGCCACCTCGAGTATGTTTTGGAGCGAAACATGGACTGCTTT
GACGTCGAAAAGGACACACCGCGGCTGCCGGGGGAACCTATATCTCGAGAGGCGACGCCAGAGACGGGGCCGGGC
CGATGGGAGGACCCGGGGCCGAGACAGGTCTTCTGCATCTGCCGCAAGATTGAGGCTGGCATGATGATTGAGTGC
GAGCTCTGCCACGAGTGGTATCATTACAAGTGCTTGAAGATTGCGCGTGGCAAGGTCAAGGAGGACGACAAGTAC
ACATGCCCGATCTGTGACTACCGCATGAAGATTCCGCGCGACGCGGCACGCCCCAAGCTCGAGGACCTGGTGACG
CTGGCCAAGGAGATGCCCATGCTGCCGTTCCAGCCTGAGGAGGAGTCGGTCCTGACGCGTATCATTGACAACGCG
CAGACGTTCCGCGACCACATTGCTCGATACTGCAACCAGCTGCTGTCGACAAAGGCCGAGGCCGAGACGCAGCGC
TTCTACCTGCGCAAACTGGAGGGGGCCGAGGTGCTCCTGGCGTACGAGACCAACTTCTTCCGCCAGGAACTGCAC
AAGTGGTGTCCCGTAGCTCCGGACGCGCCGCCCATCATGGACAAGTCCAACAGCACACGCAAGCCGAGGCCTACG
AAGCTGCAGAAGATGCTGGCCGAGTACGGCGTCGACAACCCGGATGATCTACCGGAGCACGCCCGGGGAAAGGCC
AATAGTCTGCGGCGCAAGGCGGCCAATGCCGAGGCTGCGGCTGCGGCGGCTGCGGCTGCGGCAGCCTCGTCTGTC
GCCGCTGCTCCGGGGGTGACGATGCCACCGTCCAACAGCCCGGCATACGGCAGCTCGGCCTTCTTCCCCGCTCGC
CCCTCGCCGTCGAGCGGTGCGGGGCCGTCTCCTCCGGGGACAGGCCGAGGTCCGGCTTCGGCGACGTCTCAAAAC
GGCGGCAAGGCGGACGACGCCAACGTCGACCCTGGACTTCATGCCGGATTCCTCGGTGCGTCGGTTCCACAACTG
GTGGCGGACAACTCGGTGCTATCGCTCGATGAGAGGCTCCTGAGGGGAGAAGACGGCAAGTCGCTCGACATGCTT
CGCCGCTCGGCCGACGACCGGCACCAGGCGATGCCCATCTGGGACGACGACGTGTGGCGGCACAACCGCGGGTCG
ATGAGTGACCGGGGGGGCTCGTTGACGCCGGCCGAGATGGAGCTGATGAAGCACGACGAGGGCAGCGTGGACCAG
ATGTTCAAGGAGATGACCAACGTGGTGGACGAGGAGGACGAGGGGAAGAAGAAGGAGACGGCTGGAGCCACCGGG
CCGGTGACGGCTGAGTCGCTGGAGAGTGAGAGAAACGGTCTCGACGCCTTGTTAGACGGGGAGTGA
Transcript >Ophcf2|05289
ATGGCGGCGGGACATACGACCACGACGAGCAAGGCCGCCGCCGCCGCCGCCGCCGCTGCCAATACGAGCAGCGCT
GATGCCAGCACTCGCAGCTCGCCCATCCCCGGCGGCGGCGCTCCGTCAAACCACACGCCCTCTTCGAACTCGAGA
CCCAAAAACAAGGTCAATACCAACGGCTACCATCCCCCGAATCCGCAGGCCCCCCTCAGCGCCATGGTCAGTCCC
GCCCTGGATCTGGCCTCGGTTGAGCGACGCGGACAGCCCACGGCGGTGCGCGAGCCTCATAGAAAGAAGACTCGA
CCCCACGGCATATCCGAGGCTCCGACCTACTGCCCGACGATCGACGAGTGGCGGGACCCGCTCGAGTACCTCAAA
TCCATCGCCCCCGAGGCCTCGCAGTACGGCATCTGCAAAATTATACCCCCTGACTCGTGGAATCCCGACTTCGCC
ATCAACACCGAGAGGTTCCACTTCCGCACTCGCAAGCAGGAACTCAACTCGGTCGAAGGCAGCACCCGTGCGAAC
CTGACGTACCTTGAAAGCCTTTTCAAGTACCACAGGCAGCAAGGCTTAAATTTACACCGCATGCCCTTTGTCGAT
AAGAAGCCGCTCGATCTGTATCGCCTGAAAAAGGCGGTAGAGTCCCGCGGCGGCTTCGACAAGGTCTGCAAGCTT
AAGAAATGGGCCGAGATCGGTCGTGATCTTGGTTATAGCGGCAAGATAATGTCCTCGCTGTCGACGTCTCTCAAG
AACTCGTACTCGCGCTGGCTCGTCCCTTATGAGGACTACCTGCGCCTCGCCAAGCCGGGTGTGCATCAGCAGCTT
GAGCAGGAGTACGGCGGGCCACTCACTCCCAGTCCCGTGCCGACTCCCATCAAGCCGTCTAACGGCAACACACCT
TCGAGCGTCAAGCCAGACTCTCCTGCTCGGCAGGCGTCCGATGCCCTGCAAGCCGGCCTCGACAAGGAACCAGAC
GTCGACACGCCAATGGTAGACACCTCGCCGGCCCCCACCGTCTCGGGAGGTTTCACGGCTATCAACACCAACGGC
TTCACCGCCGTCAATTCGGCCAATCGGTCCGCCAACACCGACGGCAAAAGGTTCACCCCGGATCCTAAGCGGCCC
GACAGCCCCACGTCATCGACCAAGGGCGCGCCCGAGGGGCGGTCGTCGGGCTTGGGTGCCGCCGCGACGCTGAAA
CGGACCCTCAGCAGCTGTGGCAGCTCGTCCGACTCAACCAAGAAGGATGCCGACGGTGTAAAGGAAGAGGGCGAG
CCGAGCAGCCGTCGTAGTAAGCGGCTGAAGAAGGATGCCGTCCCGACCGTGGCGGGCTCGCACATGACGCTTTTC
CGCCCTTCGGTGCCCCGTATTCCTCGCGAGGAGGCGGCGGGAAGTACGGAAAAATGCGAAAACTGCGGCAGAGGT
GACGACGCCGGCTCGCTGCTCGTGTGCGAGTCGTGCGATAATGTCTATCACGGCCCCTGTCTCGACCCTCCGCTG
AAGCGCAAACCAGAGGCCGAATGGAACTGTCCACGCTGCCTCGTCGGCGACGGCCAGTTCGGGTTTGAGGAGGGC
GGGCTGTACTCGCTGCGCCAGTTCCAGCAAAAGGCAAATGACTTCAAGCAGGGCTACTTTGAGAAGAAGATGCCT
TTCGATCACGCCCTCAACTGCCACCGCCCCGTCACCGAACAGGACGTCGAGACCGAATTCTGGCGTCTGGTCGCC
GACCTGGAGGAGACGGTCGAGGTCGAGTACGGCGCCGATATTCATTGCACCACGCACGGCTCCGGCTTCCCGACC
GTGGAGAAGAATCCAAACAATCCTTACGCGACGGACCCTTGGAACCTCAATGTGCTGCCCTTCCATGCCGAGAGC
CTCTTTCGACATATCAAGTCAGACATCTCGGGTATGACGGTGCCCTGGGTGTATGTAGGCATGATCTTCTCCACG
TTTTGCTGGCACAACGAGGACCACTACGCCTATTCGGCCAACTACCAGCACTTCGGCGCCACCAAGACGTGGTAC
GGGATTCCTGGGGAAGACGCCGAGAAGTTCGAGTCCGCCATGAAGGAGGCCGTCCCCGAGCTCTTTGAGACGCAG
CCGGATCTGCTGTTTCAGCTCGTGACGCTTCTCACGCCCGAGCAGCTGAAGAAAGCAGGCGTACGCGTCTACGCC
CTTGATCAGCGAGCTGGCCAGTTCGTCATAACCTTTCCCCAGGCCTATCACGCCGGCTTCAACCACGGCTTCAAC
TTCAACGAGGCCGTTAACTTCGCCCCCTGCGACTGGGAGCCTTTCGGGCAGGCCGGCGTTGAGAGGCTGCAGCTG
TTCCGGCGACAGCCGTGCTTCTCGCACGACGAGCTGCTGTGGACTGCCGCCGAGGGCAGCGCGGCCTCTGGTCTC
ACCATACAGACGGCCAAGTGGCTCGCTCCGGCCCTTGACCGGATCCAGAAGCGCGAGGCGGCGCAGCGGGACATG
TTTGTCGCCAAACACGCCGAGGCCTCGCCTCATCAGTGTCGTTTGACGGGCGAAGGCGACGGAGACGGCAGCTGC
CCGATGACCTTTGCCATCGAGGACAAGGACGTGACAGATGAAGATGAGCAGTGCTGCAGCCATTGCAAGGCTTTT
GCTTACCTGTCCCGCTTCAAGTGCCAGCGGTCCGGCAAGGTGCTCTGCATCCTGCACGCCGGTTCCCATGCATGC
TGCGACCAGACGGAGCAGCAGAGGTACCTCGGGGACGAGCATGTCCTCTATCACCGAAAGGCCGACGACGTCATC
AAGGCAACGTGCGACAAGGTCGTGCAAAAGGCCCGCACCCCGGAGCTTTGGGAGGAAAAGTACACGACCATTCTC
GACGACGAGGCTACGCCGTCGCTCAAGACGTTGAGGAGCCTGCTCAATGAGGGCGAGCGCATCCCCTACGACCTC
CCGTCTCTCCCGGTCCTCAAAGGATTCGTCGACCGGTGCAACGACTGGGTCGACGAGGCCACCAACTACATCGTC
CGCAAGCAGCAGGTGCGCAGGAAGAGTGACAAGGTCTTGCAGGGCGGCGCGCGCAAGTCGAGCCAGGAGCAAAAG
GAGCGTGAGTCGCGCAACGTAACCAACATACATCGCCTACTGAGAGAGGCCGACCACATCGGCTTCGACTGTCCC
GAAATCGGCCAGCTACAGGAGCGGGCTACCGCCATCAAAACGTTTCAGATGAGCGCCTCTCGGGTGCTGGAGAAT
ACGGCATCGACGGCGGTGGAGACGATCGAGGAGCTGCTCGAGCAAGGGCGGAGTTTCAACGTGGACATGCCCGAG
GTCGACGGCCTGTCGCGGATTCTCGAGCAGATGCGCTGGAACGACAAGGCTCGCGAAGATCGCAGGACCTTGCTG
TCGCTGCAGTACGTTCAGGAGATGATTGACGAGGGCAAGCGGCTCGAGATACCCAGCTACAACGACCACCTCAAG
TATTTCCGCGACCAGCTGCAGGCGGGCGAGGCGTGGGAGCGCAAGGCCAAGGAGCTCATCGACGCCGAGACGGTG
CACTACCCTCAGCTCGAGGCGCTTTCCAGCCAGGTGCAAGTCAACCTGCTGCCGGTATCGATCGAGACGCTCAAC
ATGGTTGATCAGATCCTTCACAAGCAGCGAGAGGCACATCGACAGATCCTGGACATTACCGAGAGGTGTCGCAGC
GATGACTTCCGCCAGCGTCCGCGGTACGCCGAGGTGGTTGAGATTTCCAAGAAGCTCGAGGACCTCAACTCGAAA
CCCAACGGTACGCTGGATCTTGAGAACGAGCGCAAGCGGCACGAGGACTGGATGCGCAAGGGGAAGAAGCTGTTT
GGAAAGTCCAACGCGCCGCTTCACATACTCAAGAGCCACCTCGAGTATGTTTTGGAGCGAAACATGGACTGCTTT
GACGTCGAAAAGGACACACCGCGGCTGCCGGGGGAACCTATATCTCGAGAGGCGACGCCAGAGACGGGGCCGGGC
CGATGGGAGGACCCGGGGCCGAGACAGGTCTTCTGCATCTGCCGCAAGATTGAGGCTGGCATGATGATTGAGTGC
GAGCTCTGCCACGAGTGGTATCATTACAAGTGCTTGAAGATTGCGCGTGGCAAGGTCAAGGAGGACGACAAGTAC
ACATGCCCGATCTGTGACTACCGCATGAAGATTCCGCGCGACGCGGCACGCCCCAAGCTCGAGGACCTGGTGACG
CTGGCCAAGGAGATGCCCATGCTGCCGTTCCAGCCTGAGGAGGAGTCGGTCCTGACGCGTATCATTGACAACGCG
CAGACGTTCCGCGACCACATTGCTCGATACTGCAACCAGCTGCTGTCGACAAAGGCCGAGGCCGAGACGCAGCGC
TTCTACCTGCGCAAACTGGAGGGGGCCGAGGTGCTCCTGGCGTACGAGACCAACTTCTTCCGCCAGGAACTGCAC
AAGTGGTGTCCCGTAGCTCCGGACGCGCCGCCCATCATGGACAAGTCCAACAGCACACGCAAGCCGAGGCCTACG
AAGCTGCAGAAGATGCTGGCCGAGTACGGCGTCGACAACCCGGATGATCTACCGGAGCACGCCCGGGGAAAGGCC
AATAGTCTGCGGCGCAAGGCGGCCAATGCCGAGGCTGCGGCTGCGGCGGCTGCGGCTGCGGCAGCCTCGTCTGTC
GCCGCTGCTCCGGGGGTGACGATGCCACCGTCCAACAGCCCGGCATACGGCAGCTCGGCCTTCTTCCCCGCTCGC
CCCTCGCCGTCGAGCGGTGCGGGGCCGTCTCCTCCGGGGACAGGCCGAGGTCCGGCTTCGGCGACGTCTCAAAAC
GGCGGCAAGGCGGACGACGCCAACGTCGACCCTGGACTTCATGCCGGATTCCTCGGTGCGTCGGTTCCACAACTG
GTGGCGGACAACTCGGTGCTATCGCTCGATGAGAGGCTCCTGAGGGGAGAAGACGGCAAGTCGCTCGACATGCTT
CGCCGCTCGGCCGACGACCGGCACCAGGCGATGCCCATCTGGGACGACGACGTGTGGCGGCACAACCGCGGGTCG
ATGAGTGACCGGGGGGGCTCGTTGACGCCGGCCGAGATGGAGCTGATGAAGCACGACGAGGGCAGCGTGGACCAG
ATGTTCAAGGAGATGACCAACGTGGTGGACGAGGAGGACGAGGGGAAGAAGAAGGAGACGGCTGGAGCCACCGGG
CCGGTGACGGCTGAGTCGCTGGAGAGTGAGAGAAACGGTCTCGACGCCTTGTTAGACGGGGAGTGA
Gene >Ophcf2|05289
ATGGCGGCGGGACATACGACCACGACGAGCAAGGCCGCCGCCGCCGCCGCCGCCGCTGCCAATACGAGCAGCGCT
GATGCCAGCACTCGCAGCTCGCCCATCCCCGGCGGCGGCGCTCCGTCAAACCACACGCCCTCTTCGAACTCGAGA
CCCAAAAACAAGGTCAATACCAACGGCTACCATCCCCCGAATCCGCAGGCCCCCCTCAGCGCCATGGTCAGTCCC
GCCCTGGATCTGGCCTCGGTTGAGCGACGCGGACAGCCCACGGCGGTGCGCGAGCCTCATAGAAAGAAGACTCGA
CCCCACGGCATATCCGAGGCTCCGACCTACTGCCCGACGATCGACGAGTGGCGGGACCCGCTCGAGTACCTCAAA
TCCATCGCCCCCGAGGCCTCGCAGTACGGCATCTGCAAAATTATACCCCCTGACTCGTGGAATCCCGACTTCGCC
ATCAACACCGAGGTACGAGTCCTTATTCACCAATGCTCCTCGAAGCATTTCATCCCCCTCTCACACACTTCGCCC
CAAACCTGTGAAATGTCTTGCTGATTCAAAAAAAAAAATGATGTAGAGGTTCCACTTCCGCACTCGCAAGCAGGA
ACTCAACTCGGTCGAAGGCAGTGGGTGATGCCCCTGCGACACCGTTGCTGGCCTTGATTCTGACTGTTCTTCCGC
AGGCACCCGTGCGAACCTGACGTACCTTGAAAGCCTTTTCAAGTACCACAGGCAGCAAGGCTTAAATTTACACCG
CATGCCCTTTGTCGATAAGAAGCCGCTCGATCTGTATCGCCTGAAAAAGGCGGTAGAGTCCCGCGGCGGCTTCGA
CAAGGTCTGCAAGCTTAAGAAATGGGCCGAGATCGGTCGTGATCTTGGTTATAGCGGCAAGATAATGTCCTCGCT
GTCGACGTCTCTCAAGAACTCGTACTCGCGCTGGCTCGTCCCTTATGAGGACTACCTGCGCCTCGCCAAGCCGGG
TGTGCATCAGCAGCTTGAGCAGGAGTACGGCGGGCCACTCACTCCCAGTCCCGTGCCGACTCCCATCAAGCCGTC
TAACGGCAACACACCTTCGAGCGTCAAGCCAGACTCTCCTGCTCGGCAGGCGTCCGATGCCCTGCAAGCCGGCCT
CGACAAGGAACCAGACGTCGACACGCCAATGGTAGACACCTCGCCGGCCCCCACCGTCTCGGGAGGTTTCACGGC
TATCAACACCAACGGCTTCACCGCCGTCAATTCGGCCAATCGGTCCGCCAACACCGACGGCAAAAGGTTCACCCC
GGATCCTAAGCGGCCCGACAGCCCCACGTCATCGACCAAGGGCGCGCCCGAGGGGCGGTCGTCGGGCTTGGGTGC
CGCCGCGACGCTGAAACGGACCCTCAGCAGCTGTGGCAGCTCGTCCGACTCAACCAAGAAGGATGCCGACGGTGT
AAAGGAAGAGGGCGAGCCGAGCAGCCGTCGTAGTAAGCGGCTGAAGAAGGGCAAGTCGTCTTCCTGCATTGCCAT
CCGGCTGATCGTCCCGTGGTGACTGACCCTTGAAATTTTAGATGCCGTCCCGACCGTGGCGGGCTCGCACATGAC
GCTTTTCCGCCCTTCGGTGCCCCGTATTCCTCGCGAGGAGGCGGCGGGAAGTACGGAAAAATGCGAAAACTGCGG
CAGAGGTGACGACGCCGGCTCGCTGCTCGTGTGCGAGTCGTGCGATAATGTCTATCACGGCCCCTGTCTCGACCC
TCCGCTGAAGCGCAAACCAGAGGCCGAATGGAACTGTCCACGCTGCCTCGTCGGCGACGGCCAGTTCGGGTTTGA
GGAGGGCGGGCTGTACTCGCTGCGCCAGTTCCAGCAAAAGGCAAATGACTTCAAGCAGGGCTACTTTGAGAAGAA
GATGCCTTTCGATCACGCCCTCAACTGCCACCGCCCCGTCACCGAACAGGACGTCGAGACCGAATTCTGGCGTCT
GGTCGCCGACCTGGAGGAGACGGTCGAGGTCGAGTACGGCGCCGATATTCATTGCACCACGCACGGCTCCGGCTT
CCCGACCGTGGAGAAGAATCCAAACAATCCTTACGCGACGGACCCTTGGAACCTCAATGTGCTGCCCTTCCATGC
CGAGAGCCTCTTTCGACATATCAAGTCAGACATCTCGGGTATGACGGTGCCCTGGGTGTATGTAGGCATGATCTT
CTCCACGTTTTGCTGGCACAACGAGGACCACTACGCCTATTCGGCCAACTACCAGCACTTCGGCGCCACCAAGAC
GTGGTACGGGATTCCTGGGGAAGACGCCGAGAAGTTCGAGTCCGCCATGAAGGAGGCCGTCCCCGAGCTCTTTGA
GACGCAGCCGGATCTGCTGTTTCAGCTCGTGACGCTTCTCACGCCCGAGCAGCTGAAGAAAGCAGGCGTACGCGT
CTACGCCCTTGATCAGCGAGCTGGCCAGTTCGTCATAACCTTTCCCCAGGCCTATCACGCCGGCTTCAACCACGG
CTTCAACTTCAACGAGGCCGTTAACTTCGCCCCCTGCGACTGGGAGCCTTTCGGGCAGGCCGGCGTTGAGAGGCT
GCAGCTGTTCCGGCGACAGCCGTGCTTCTCGCACGACGAGCTGCTGTGGACTGCCGCCGAGGGCAGCGCGGCCTC
TGGTCTCACCATACAGACGGCCAAGTGGCTCGCTCCGGCCCTTGACCGGATCCAGAAGCGCGAGGCGGCGCAGCG
GGACATGTTTGTCGCCAAACACGCCGAGGCCTCGCCTCATCAGTGTCGTTTGACGGGCGAAGGCGACGGAGACGG
CAGCTGCCCGATGACCTTTGCCATCGAGGACAAGGACGTGACAGATGAAGATGAGCAGTGCTGCAGCCATTGCAA
GGCTTTTGCTTACCTGTCCCGCTTCAAGTGCCAGCGGTCCGGCAAGGTGCTCTGCATCCTGCACGCCGGTTCCCA
TGCATGCTGCGACCAGACGGAGCAGCAGAGGTACCTCGGGGACGAGCATGTCCTCTATCACCGAAAGGCCGACGA
CGTCATCAAGGCAACGTGCGACAAGGTCGTGCAAAAGGCCCGCACCCCGGAGCTTTGGGAGGAAAAGTACACGAC
CATTCTCGACGACGAGGCTACGCCGTCGCTCAAGACGTTGAGGAGCCTGCTCAATGAGGGCGAGCGCATCCCCTA
CGACCTCCCGTCTCTCCCGGTCCTCAAAGGATTCGTCGACCGGTGCAACGACTGGGTCGACGAGGCCACCAACTA
CATCGTCCGCAAGCAGCAGGTGCGCAGGAAGAGTGACAAGGTCTTGCAGGGCGGCGCGCGCAAGTCGAGCCAGGA
GCAAAAGGAGCGTGAGTCGCGCAACGTAACCAACATACATCGCCTACTGAGAGAGGCCGACCACATCGGCTTCGA
CTGTCCCGAAATCGGCCAGCTACAGGAGCGGGCTACCGCCATCAAAACGTTTCAGATGAGCGCCTCTCGGGTGCT
GGAGAATACGGCATCGACGGCGGTGGAGACGATCGAGGAGCTGCTCGAGCAAGGGCGGAGTTTCAACGTGGACAT
GCCCGAGGTCGACGGCCTGTCGCGGATTCTCGAGCAGATGCGCTGGAACGACAAGGCTCGCGAAGATCGCAGGAC
CTTGCTGTCGCTGCAGTACGTTCAGGAGATGATTGACGAGGGCAAGCGGCTCGAGATACCCAGCTACAACGACCA
CCTCAAGTATTTCCGCGACCAGCTGCAGGCGGGCGAGGCGTGGGAGCGCAAGGCCAAGGAGCTCATCGACGCCGA
GACGGTGCACTACCCTCAGCTCGAGGCGCTTTCCAGCCAGGTGCAAGTCAACCTGCTGCCGGTATCGATCGAGAC
GCTCAACATGGTTGATCAGATCCTTCACAAGCAGCGAGAGGCACATCGACAGATCCTGGACATTACCGAGAGGTG
TCGCAGCGATGACTTCCGCCAGCGTCCGCGGTACGCCGAGGTGGTTGAGATTTCCAAGAAGCTCGAGGACCTCAA
CTCGAAACCCAACGGTACGCTGGATCTTGAGAACGAGCGCAAGCGGCACGAGGACTGGATGCGCAAGGGGAAGAA
GCTGTTTGGAAAGTCCAACGCGCCGCTTCACATACTCAAGAGCCACCTCGAGTATGTTTTGGAGCGAAACATGGA
CTGCTTTGACGTCGAAAAGGACACACCGCGGCTGCCGGGGGAACCTATATCTCGAGAGGCGACGCCAGAGACGGG
GCCGGGCCGATGGGAGGACCCGGGGCCGAGACAGGTCTTCTGCATCTGCCGCAAGATTGAGGCTGGCATGATGAT
TGAGTGCGAGCTCTGCCACGAGTGGTCAGCATCTGTTCGCCATCGACCGTTGCTATCATCTGCTGACGTACCTTT
ACCAGGTATCATTACAAGTGCTTGAAGATTGCGCGTGGCAAGGTCAAGGAGGACGACAAGTACACATGCCCGATC
TGTGACTACCGCATGAAGATTCCGCGCGACGCGGCACGCCCCAAGCTCGAGGACCTGGTGACGCTGGCCAAGGAG
ATGCCCATGCTGCCGTTCCAGCCTGAGGAGGAGTCGGTCCTGACGCGTATCATTGACAACGCGCAGACGTTCCGC
GACCACATTGCTCGATACTGCAACCAGCTGCTGTCGACAAAGGCCGAGGCCGAGACGCAGCGCTTCTACCTGCGC
AAACTGGAGGGGGCCGAGGTGCTCCTGGCGTACGAGACCAACTTCTTCCGCCAGGAACTGCACAAGTGGTGTCCC
GTAGCTCCGGACGCGCCGCCCATCATGGACAAGTCCAACAGCACACGCAAGCCGAGGCCTACGAAGCTGCAGAAG
ATGCTGGCCGAGTACGGCGTCGACAACCCGGATGATCTACCGGAGCACGCCCGGGGAAAGGCCAATAGTCTGCGG
CGCAAGGCGGCCAATGCCGAGGCTGCGGCTGCGGCGGCTGCGGCTGCGGCAGCCTCGTCTGTCGCCGCTGCTCCG
GGGGTGACGATGCCACCGTCCAACAGCCCGGCATACGGCAGCTCGGCCTTCTTCCCCGCTCGCCCCTCGCCGTCG
AGCGGTGCGGGGCCGTCTCCTCCGGGGACAGGCCGAGGTCCGGCTTCGGCGACGTCTCAAAACGGCGGCAAGGCG
GACGACGCCAACGTCGACCCTGGACTTCATGCCGGATTCCTCGGTGCGTCGGTTCCACAACTGGTGGCGGACAAC
TCGGTGCTATCGCTCGATGAGAGGCTCCTGAGGGGAGAAGACGGCAAGTCGCTCGACATGCTTCGCCGCTCGGCC
GACGACCGGCACCAGGCGATGCCCATCTGGGACGACGACGTGTGGCGGCACAACCGCGGGTCGATGAGTGACCGG
GGGGGCTCGTTGACGCCGGCCGAGATGGAGCTGATGAAGCACGACGAGGGCAGCGTGGACCAGATGTTCAAGGAG
ATGACCAACGTGGTGGACGAGGAGGACGAGGGGAAGAAGAAGGAGACGGCTGGAGCCACCGGGCCGGTGACGGCT
GAGTCGCTGGAGAGTGAGAGAAACGGTCTCGACGCCTTGTTAGACGGGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail