Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05287
Gene name
Locationscaffold_05:3150390..3151720
Strand+
Gene length (bp)1330
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-12 93 311

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 63 85 22
3 126 145 19
4 175 192 17
5 242 259 17
6 266 288 22
7 338 360 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05287
MADAFDFHALSVQTVKLASHYGRSKTDVTLAITLTLLLRSVGAAGFGLAGDRWGRKWPMVANMLVLGALQVATIY
CDTYIQFLGVRSLFATGGLMSGILQQGYSLGYVLAAGANLGVGDGHGSWKTVFWIGAGFSITIGLLRALLPNPNP
PKHQSQTATSFWRTTKRMLRKECKMCTYCILLMTWFNYYSHVSQDSYTTFMLTQKQLDNAAASRASIVMKAGACV
GGCILGHVSQTLGRRRTIVMAALASGFMIPAWILPKGERALSATGFLMQFFVQGAWGVIPVHLNELSPDAFRATF
PGVTYQIGNMLASPAAQMVNAVAERIFITVEGGHMVEAYGPVLGVSTAIVVIAIVITVAFGPERHGRSFGLETDD
VREEADDESKRTVVVSEIQR*
Coding >Ophcf2|05287
ATGGCCGACGCCTTCGACTTCCACGCTCTTTCTGTACAAACCGTCAAGCTGGCCTCGCATTATGGACGGAGCAAG
ACGGATGTTACGCTCGCCATCACTCTCACGCTGCTGCTGAGGAGCGTCGGCGCCGCTGGTTTCGGACTTGCTGGT
GATCGGTGGGGACGCAAGTGGCCCATGGTCGCCAACATGCTCGTTCTGGGCGCTCTACAGGTGGCCACCATCTAC
TGCGACACTTACATCCAGTTCCTCGGTGTCCGCAGTCTATTCGCAACGGGCGGTCTCATGTCCGGCATCCTACAG
CAGGGCTACTCCCTCGGCTACGTCCTCGCCGCCGGAGCAAACCTCGGAGTTGGAGACGGCCACGGAAGCTGGAAG
ACAGTCTTCTGGATCGGAGCCGGCTTCTCCATCACCATCGGCCTCCTCCGAGCCCTCCTCCCGAATCCCAACCCC
CCCAAACACCAAAGCCAGACAGCCACCTCCTTCTGGCGAACCACCAAGCGAATGCTCCGTAAAGAATGCAAAATG
TGCACCTACTGCATCCTCCTGATGACCTGGTTCAACTACTACTCCCACGTCTCGCAGGACTCCTACACAACCTTT
ATGCTAACTCAAAAACAGCTCGACAACGCCGCCGCCTCCCGCGCCTCCATCGTCATGAAGGCCGGCGCCTGCGTC
GGAGGCTGCATTCTAGGCCACGTAAGCCAGACGCTCGGCCGCCGACGGACCATTGTCATGGCAGCCCTCGCTTCG
GGATTCATGATCCCGGCTTGGATCCTTCCGAAGGGAGAGCGCGCCCTGAGTGCAACGGGCTTTCTGATGCAGTTC
TTCGTCCAGGGAGCATGGGGCGTCATCCCCGTTCACCTCAACGAGCTGTCGCCCGATGCCTTCCGCGCCACGTTC
CCGGGCGTGACGTATCAGATAGGCAACATGCTAGCATCGCCAGCAGCGCAAATGGTCAACGCCGTGGCGGAGCGC
ATCTTCATCACCGTCGAGGGCGGCCACATGGTCGAGGCGTACGGGCCGGTACTGGGCGTCTCCACGGCCATCGTC
GTCATCGCCATCGTCATCACCGTCGCATTCGGACCCGAGAGACACGGACGGAGCTTCGGGCTCGAGACCGACGAC
GTCAGAGAGGAAGCCGATGACGAGAGCAAGAGGACCGTTGTCGTCAGCGAGATCCAGAGATAG
Transcript >Ophcf2|05287
ATGGCCGACGCCTTCGACTTCCACGCTCTTTCTGTACAAACCGTCAAGCTGGCCTCGCATTATGGACGGAGCAAG
ACGGATGTTACGCTCGCCATCACTCTCACGCTGCTGCTGAGGAGCGTCGGCGCCGCTGGTTTCGGACTTGCTGGT
GATCGGTGGGGACGCAAGTGGCCCATGGTCGCCAACATGCTCGTTCTGGGCGCTCTACAGGTGGCCACCATCTAC
TGCGACACTTACATCCAGTTCCTCGGTGTCCGCAGTCTATTCGCAACGGGCGGTCTCATGTCCGGCATCCTACAG
CAGGGCTACTCCCTCGGCTACGTCCTCGCCGCCGGAGCAAACCTCGGAGTTGGAGACGGCCACGGAAGCTGGAAG
ACAGTCTTCTGGATCGGAGCCGGCTTCTCCATCACCATCGGCCTCCTCCGAGCCCTCCTCCCGAATCCCAACCCC
CCCAAACACCAAAGCCAGACAGCCACCTCCTTCTGGCGAACCACCAAGCGAATGCTCCGTAAAGAATGCAAAATG
TGCACCTACTGCATCCTCCTGATGACCTGGTTCAACTACTACTCCCACGTCTCGCAGGACTCCTACACAACCTTT
ATGCTAACTCAAAAACAGCTCGACAACGCCGCCGCCTCCCGCGCCTCCATCGTCATGAAGGCCGGCGCCTGCGTC
GGAGGCTGCATTCTAGGCCACGTAAGCCAGACGCTCGGCCGCCGACGGACCATTGTCATGGCAGCCCTCGCTTCG
GGATTCATGATCCCGGCTTGGATCCTTCCGAAGGGAGAGCGCGCCCTGAGTGCAACGGGCTTTCTGATGCAGTTC
TTCGTCCAGGGAGCATGGGGCGTCATCCCCGTTCACCTCAACGAGCTGTCGCCCGATGCCTTCCGCGCCACGTTC
CCGGGCGTGACGTATCAGATAGGCAACATGCTAGCATCGCCAGCAGCGCAAATGGTCAACGCCGTGGCGGAGCGC
ATCTTCATCACCGTCGAGGGCGGCCACATGGTCGAGGCGTACGGGCCGGTACTGGGCGTCTCCACGGCCATCGTC
GTCATCGCCATCGTCATCACCGTCGCATTCGGACCCGAGAGACACGGACGGAGCTTCGGGCTCGAGACCGACGAC
GTCAGAGAGGAAGCCGATGACGAGAGCAAGAGGACCGTTGTCGTCAGCGAGATCCAGAGATAG
Gene >Ophcf2|05287
ATGGCCGACGCCTTCGACTTCCACGCTCTTTCTGTACAAACCGTCAAGCTGGCCTCGCATTATGGACGGAGCAAG
ACGGATGTTACGCTCGCCATCACTCTCACGCTGCTGCTGAGGAGCGTCGGCGCCGCTGGTTTCGGACTTGCTGGT
GATCGGTGGGGACGCAAGTGGCCCATGGTCGCCAACATGCTCGTTCTGGGCGCTCTACAGGTGGCCACCATCTAC
TGCGACACTTACATCCAGTTCCTCGGTGTCCGCAGTCTATTCGGTCTGTTCATGGGGGGAGTATACGGGAATGCC
ATTGCCACGGCTCTGGAGATGTGCCCGTTCGTATTTTTTTCCCCTTGTGTTCTGATCGAGGAACAGCAACGGGCG
GTCTCATGTCCGGCATCCTACAGCAGGGCTACTCCCTCGGCTACGTCCTCGCCGCCGGAGCAAACCTCGGAGTTG
GAGACGGCCACGGAAGCTGGAAGACAGTCTTCTGGATCGGAGGTGCCCCCGGGACCCGTCCGATGAACAAAGACT
CAAGTCCGCAGCCGGCTTCTCCATCACCATCGGCCTCCTCCGAGCCCTCCTCCCGAATCCCAACCCCCCCAAACA
CCAAAGCCAGACAGCCACCTCCTTCTGGCGAACCACCAAGCGAATGCTCCGTAAAGAATGCAAAATGTGCACCTA
CTGCATCCTCCTGATGACCTGGTTCAACTACTACTCCCACGTCTCGCAGGACTCCTACACAACCTTTATGCTAAC
TCAAAAACAGCTCGACAACGCCGCCGCCTCCCGCGCCTCCATCGTCATGAAGGCCGGCGCCTGCGTCGGAGGCTG
CATTCTAGGCCACGTAAGCCAGACGCTCGGCCGCCGACGGACCATTGTCATGGCAGCCCTCGCTTCGGGATTCAT
GATCCCGGCTTGGATCCTTCCGAAGGGAGAGCGCGCCCTGAGTGCAACGGGCTTTCTGATGCAGTTCTTCGTCCA
GGGAGCATGGGGCGTCATCCCCGTTCACCTCAACGAGCTGTCGCCCGATGCCTTCCGCGCCACGTTCCCGGGCGT
GACGTATCAGATAGGCAACATGCTAGCATCGCCAGCAGCGCAAATGGTCAACGCCGTGGCGGAGCGCATCTTCAT
CACCGTCGAGGGCGGCCACATGGTCGAGGCGTACGGGCCGGTACTGGGCGTCTCCACGGCCATCGTCGTCATCGC
CATCGTCATCACCGTCGCATTCGGACCCGAGAGACACGGACGGAGCTTCGGGCTCGAGACCGACGACGTCAGAGA
GGAAGCCGATGACGAGAGCAAGAGGACCGTTGTCGTCAGCGAGATCCAGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail