Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05286
Gene name
Locationscaffold_05:3147054..3149691
Strand+
Gene length (bp)2637
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.4E-136 54 790

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 59 76 17
2 129 151 22
3 163 185 22
4 189 211 22
5 231 253 22
6 268 290 22
7 303 325 22
8 374 396 22
9 485 507 22
10 511 533 22
11 540 562 22
12 602 624 22
13 664 686 22
14 706 728 22
15 735 757 22
16 772 794 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05286
MRLRMRRLLLGPEAYGAFYGRDLRIDAVMLRWSSPYPGVRAVACPVDEIDVPTETVRAYFLGIGWAILGTFFSTF
FNSRFPSIALNGSVIQILLYPCAKVLERSLPDKGPTILGTRHSLNPGPWTFKEQMFATITYNIAIYTTNSYGMIL
VQKSPEYYGLDFVSFGYQLTLTLFVQLMGMGFAGFLRRFSVYPVKALWPTILPVIAMNRALTTDRWTTGPADGWT
VSRYRFFCTVAGGMFVYYWLPGYLFTALSQFNWMTWIDPSNLTLAILTGSNLGLGLLNPVSTLDWNVATSSYAAL
SQPFFSTLTMYCGSILGGLIILAMYYSNQYDTAYLPINSSSAFANDGKPYQVQRIMVNNRLDLDRYQSYSPPFYS
AGYVLTVGANFAFYPVYFLYVMGNQWMTMAKAFSDFYRSVFRRDRGSNSNNDNDDDDDNNINNINNINNINNINN
INNNINNINSSNSNYAPNNDIHTRLMSRYSEVPDWWFLAILASAVTVSIIFVRLYPIETPIWLVFLLIAINLVFA
VPLSFLSATTGTNLGLGSLIQIITGYLLPGNPNAFLFGQTLGSWALAGYGDNYVQDQKMAHYCRIAPRAVFRSQM
STIFVTCFVAVATQHLILSRVPALCTPTQPSRFTCAADGAPLYASSLMWGVLGSHRMFASLYPLLKWCFLMGAVI
ALLFLVGQGLGPRYLPPIRQRLQSSLPPHVFSALDRTVFPLIASMLWLNPVLVIQGIQHWAPSNLAFKTPGMLLS
LIFMYWLPRRKPAWWTRYNYTLSAALTAGLALSALVIFFALGFHPVKLSWWGNRVSAAGVDGSTVGLLPLPARGY
FGPDRERFPRPHSGSVPRSAPHQTAGTSL*
Coding >Ophcf2|05286
ATGCGCCTCCGTATGCGTCGCCTCCTCCTCGGCCCGGAAGCCTACGGCGCCTTCTACGGCCGGGATCTGCGCATC
GATGCCGTCATGCTTCGCTGGTCTTCGCCCTATCCCGGTGTCAGGGCTGTGGCTTGTCCCGTCGATGAGATTGAT
GTCCCGACCGAGACTGTTCGGGCTTATTTCTTGGGCATCGGTTGGGCCATCTTGGGGACCTTCTTTTCCACCTTT
TTCAACAGCCGGTTTCCCTCCATCGCCCTCAACGGCTCCGTCATCCAAATCCTCCTCTACCCCTGCGCCAAAGTC
CTCGAACGCTCCCTCCCAGACAAAGGCCCGACAATCCTCGGAACCCGCCACTCGCTCAACCCGGGCCCCTGGACC
TTTAAAGAGCAAATGTTCGCGACGATAACGTACAACATCGCCATCTACACCACAAACAGCTACGGCATGATCCTC
GTCCAGAAATCCCCGGAATACTACGGCCTCGACTTCGTCTCTTTCGGTTACCAGCTCACCCTCACCCTCTTCGTA
CAGCTCATGGGCATGGGCTTCGCCGGATTCCTCCGTAGGTTCAGCGTTTATCCCGTCAAAGCCCTCTGGCCCACC
ATCCTCCCCGTCATCGCCATGAACAGGGCCCTCACTACGGATAGATGGACGACCGGACCGGCAGACGGCTGGACC
GTGTCACGCTACCGCTTCTTCTGCACCGTAGCCGGCGGAATGTTCGTCTACTACTGGCTTCCGGGCTACCTCTTC
ACCGCGCTCTCGCAGTTCAACTGGATGACATGGATCGACCCGTCCAACCTGACGCTCGCCATCCTCACAGGCTCC
AACCTCGGCCTCGGGCTCCTCAACCCCGTGAGCACGCTCGACTGGAACGTAGCGACATCTTCCTACGCAGCCCTC
TCGCAACCCTTCTTCAGCACCCTGACCATGTACTGCGGCAGTATCCTGGGCGGCCTCATCATCCTGGCCATGTAC
TACAGCAACCAGTACGACACGGCCTACCTCCCCATCAACTCATCCTCGGCCTTTGCCAACGACGGGAAGCCCTAC
CAAGTGCAACGCATCATGGTCAACAACAGGCTGGACCTGGACCGCTACCAGTCGTACTCGCCTCCTTTCTACTCG
GCCGGCTACGTGCTGACGGTGGGCGCCAACTTTGCCTTTTACCCGGTGTACTTTTTGTACGTCATGGGGAATCAG
TGGATGACCATGGCCAAGGCGTTTTCCGATTTCTACCGTAGCGTATTCCGCCGTGACCGCGGCAGCAACAGTAAC
AACGACAACGACGACGACGACGACAACAACATCAACAACATCAACAACATCAACAACATCAACAACATCAACAAC
ATCAACAACAACATCAACAACATCAACTCCAGCAACTCAAACTACGCCCCCAACAACGACATCCACACCCGCCTC
ATGTCCCGCTACAGCGAAGTCCCAGACTGGTGGTTCCTCGCCATCCTCGCCAGCGCAGTAACCGTATCCATCATC
TTCGTCCGCCTCTACCCCATCGAAACCCCCATCTGGCTCGTCTTCCTCCTCATAGCCATAAACCTCGTCTTCGCC
GTCCCCCTCTCCTTCCTGTCCGCGACGACAGGCACAAACCTCGGCCTCGGCTCCCTCATCCAGATCATCACCGGC
TACCTCCTTCCCGGCAACCCCAACGCCTTTCTCTTCGGTCAGACGCTCGGCTCCTGGGCTCTGGCTGGCTACGGT
GACAACTACGTGCAGGATCAGAAGATGGCCCATTACTGTCGGATCGCGCCCCGGGCCGTCTTTCGTAGCCAGATG
AGTACCATCTTCGTCACCTGCTTCGTCGCCGTCGCCACGCAGCACCTCATCCTCTCTCGGGTTCCAGCTCTCTGC
ACGCCTACACAGCCGAGCCGCTTCACCTGTGCGGCAGACGGGGCGCCTCTGTACGCCAGCTCGCTCATGTGGGGA
GTCCTGGGCTCTCACCGAATGTTCGCATCTTTATACCCGCTGCTAAAGTGGTGCTTCCTCATGGGAGCCGTCATC
GCTCTCCTGTTCCTCGTCGGCCAGGGTCTGGGACCACGATACCTTCCTCCCATCCGACAACGACTCCAATCCTCA
CTCCCTCCCCACGTCTTCTCGGCCCTCGACCGCACCGTCTTCCCACTCATAGCCTCGATGCTCTGGCTCAACCCC
GTACTCGTCATCCAGGGCATCCAACACTGGGCCCCCTCCAACCTCGCCTTCAAAACACCCGGCATGCTCCTATCC
CTCATCTTCATGTACTGGCTCCCGCGCCGCAAGCCAGCCTGGTGGACACGCTACAACTACACCCTCTCCGCCGCC
CTGACAGCCGGTCTCGCCCTCAGCGCCCTCGTCATCTTCTTCGCCCTCGGCTTCCACCCCGTGAAGCTCTCCTGG
TGGGGCAACCGCGTCAGCGCCGCCGGCGTCGACGGCTCCACTGTCGGACTCCTCCCGCTTCCGGCCCGTGGATAC
TTTGGTCCGGACCGGGAACGTTTCCCTAGGCCCCACTCCGGATCCGTTCCCCGTTCGGCTCCCCACCAAACGGCC
GGAACAAGCCTATGA
Transcript >Ophcf2|05286
ATGCGCCTCCGTATGCGTCGCCTCCTCCTCGGCCCGGAAGCCTACGGCGCCTTCTACGGCCGGGATCTGCGCATC
GATGCCGTCATGCTTCGCTGGTCTTCGCCCTATCCCGGTGTCAGGGCTGTGGCTTGTCCCGTCGATGAGATTGAT
GTCCCGACCGAGACTGTTCGGGCTTATTTCTTGGGCATCGGTTGGGCCATCTTGGGGACCTTCTTTTCCACCTTT
TTCAACAGCCGGTTTCCCTCCATCGCCCTCAACGGCTCCGTCATCCAAATCCTCCTCTACCCCTGCGCCAAAGTC
CTCGAACGCTCCCTCCCAGACAAAGGCCCGACAATCCTCGGAACCCGCCACTCGCTCAACCCGGGCCCCTGGACC
TTTAAAGAGCAAATGTTCGCGACGATAACGTACAACATCGCCATCTACACCACAAACAGCTACGGCATGATCCTC
GTCCAGAAATCCCCGGAATACTACGGCCTCGACTTCGTCTCTTTCGGTTACCAGCTCACCCTCACCCTCTTCGTA
CAGCTCATGGGCATGGGCTTCGCCGGATTCCTCCGTAGGTTCAGCGTTTATCCCGTCAAAGCCCTCTGGCCCACC
ATCCTCCCCGTCATCGCCATGAACAGGGCCCTCACTACGGATAGATGGACGACCGGACCGGCAGACGGCTGGACC
GTGTCACGCTACCGCTTCTTCTGCACCGTAGCCGGCGGAATGTTCGTCTACTACTGGCTTCCGGGCTACCTCTTC
ACCGCGCTCTCGCAGTTCAACTGGATGACATGGATCGACCCGTCCAACCTGACGCTCGCCATCCTCACAGGCTCC
AACCTCGGCCTCGGGCTCCTCAACCCCGTGAGCACGCTCGACTGGAACGTAGCGACATCTTCCTACGCAGCCCTC
TCGCAACCCTTCTTCAGCACCCTGACCATGTACTGCGGCAGTATCCTGGGCGGCCTCATCATCCTGGCCATGTAC
TACAGCAACCAGTACGACACGGCCTACCTCCCCATCAACTCATCCTCGGCCTTTGCCAACGACGGGAAGCCCTAC
CAAGTGCAACGCATCATGGTCAACAACAGGCTGGACCTGGACCGCTACCAGTCGTACTCGCCTCCTTTCTACTCG
GCCGGCTACGTGCTGACGGTGGGCGCCAACTTTGCCTTTTACCCGGTGTACTTTTTGTACGTCATGGGGAATCAG
TGGATGACCATGGCCAAGGCGTTTTCCGATTTCTACCGTAGCGTATTCCGCCGTGACCGCGGCAGCAACAGTAAC
AACGACAACGACGACGACGACGACAACAACATCAACAACATCAACAACATCAACAACATCAACAACATCAACAAC
ATCAACAACAACATCAACAACATCAACTCCAGCAACTCAAACTACGCCCCCAACAACGACATCCACACCCGCCTC
ATGTCCCGCTACAGCGAAGTCCCAGACTGGTGGTTCCTCGCCATCCTCGCCAGCGCAGTAACCGTATCCATCATC
TTCGTCCGCCTCTACCCCATCGAAACCCCCATCTGGCTCGTCTTCCTCCTCATAGCCATAAACCTCGTCTTCGCC
GTCCCCCTCTCCTTCCTGTCCGCGACGACAGGCACAAACCTCGGCCTCGGCTCCCTCATCCAGATCATCACCGGC
TACCTCCTTCCCGGCAACCCCAACGCCTTTCTCTTCGGTCAGACGCTCGGCTCCTGGGCTCTGGCTGGCTACGGT
GACAACTACGTGCAGGATCAGAAGATGGCCCATTACTGTCGGATCGCGCCCCGGGCCGTCTTTCGTAGCCAGATG
AGTACCATCTTCGTCACCTGCTTCGTCGCCGTCGCCACGCAGCACCTCATCCTCTCTCGGGTTCCAGCTCTCTGC
ACGCCTACACAGCCGAGCCGCTTCACCTGTGCGGCAGACGGGGCGCCTCTGTACGCCAGCTCGCTCATGTGGGGA
GTCCTGGGCTCTCACCGAATGTTCGCATCTTTATACCCGCTGCTAAAGTGGTGCTTCCTCATGGGAGCCGTCATC
GCTCTCCTGTTCCTCGTCGGCCAGGGTCTGGGACCACGATACCTTCCTCCCATCCGACAACGACTCCAATCCTCA
CTCCCTCCCCACGTCTTCTCGGCCCTCGACCGCACCGTCTTCCCACTCATAGCCTCGATGCTCTGGCTCAACCCC
GTACTCGTCATCCAGGGCATCCAACACTGGGCCCCCTCCAACCTCGCCTTCAAAACACCCGGCATGCTCCTATCC
CTCATCTTCATGTACTGGCTCCCGCGCCGCAAGCCAGCCTGGTGGACACGCTACAACTACACCCTCTCCGCCGCC
CTGACAGCCGGTCTCGCCCTCAGCGCCCTCGTCATCTTCTTCGCCCTCGGCTTCCACCCCGTGAAGCTCTCCTGG
TGGGGCAACCGCGTCAGCGCCGCCGGCGTCGACGGCTCCACTGTCGGACTCCTCCCGCTTCCGGCCCGTGGATAC
TTTGGTCCGGACCGGGAACGTTTCCCTAGGCCCCACTCCGGATCCGTTCCCCGTTCGGCTCCCCACCAAACGGCC
GGAACAAGCCTATGA
Gene >Ophcf2|05286
ATGCGCCTCCGTATGCGTCGCCTCCTCCTCGGCCCGGAAGCCTACGGCGCCTTCTACGGCCGGGATCTGCGCATC
GATGCCGTCATGCTTCGCTGGTCTTCGCCCTATCCCGGTGTCAGGGCTGTGGCTTGTCCCGTCGATGAGATTGAT
GTCCCGACCGAGACTGTTCGGGCTTATTTCTTGGGCATCGGTTGGGCCATCTTGGGGACCTTCTTTTCCACCTTT
TTCAACAGCCGGTTTCCCTCCATCGGTAAGCCGGCTCGATGCCACAACACCTTATCCCTCTATAGACCTCCTCAA
GGCTCCCGACTAACTGGCTCAGCCCTCAACGGCTCCGTCATCCAAATCCTCCTCTACCCCTGCGCCAAAGTCCTC
GAACGCTCCCTCCCAGACAAAGGCCCGACAATCCTCGGAACCCGCCACTCGCTCAACCCGGGCCCCTGGACCTTT
AAAGAGCAAATGTTCGCGACGATAACGTACAACATCGCCATCTACACCACAAACAGCTACGGCATGATCCTCGTC
CAGAAATCCCCGGAATACTACGGCCTCGACTTCGTCTCTTTCGGTTACCAGCTCACCCTCACCCTCTTCGTACAG
CTCATGGGCATGGGCTTCGCCGGATTCCTCCGTAGGTTCAGCGTTTATCCCGTCAAAGCCCTCTGGCCCACCATC
CTCCCCGTCATCGCCATGAACAGGGCCCTCACTACGGATAGATGGACGACCGGACCGGCAGACGGCTGGACCGTG
TCACGCTACCGCTTCTTCTGCACCGTAGCCGGCGGAATGTTCGTCTACTACTGGCTTCCGGGCTACCTCTTCACC
GCGCTCTCGCAGTTCAACTGGATGACATGGATCGACCCGTCCAACCTGACGCTCGCCATCCTCACAGGCTCCAAC
CTCGGCCTCGGGCTCCTCAACCCCGTGAGCACGCTCGACTGGAACGTAGCGACATCTTCCTACGCAGCCCTCTCG
CAACCCTTCTTCAGCACCCTGACCATGTACTGCGGCAGTATCCTGGGCGGCCTCATCATCCTGGCCATGTACTAC
AGCAACCAGTACGACACGGCCTACCTCCCCATCAACTCATCCTCGGCCTTTGCCAACGACGGGAAGCCCTACCAA
GTGCAACGCATCATGGTCAACAACAGGCTGGACCTGGACCGCTACCAGTCGTACTCGCCTCCTTTCTACTCGGCC
GGCTACGTGCTGACGGTGGGCGCCAACTTTGCCTTTTACCCGGTGTACTTTTTGTACGTCATGGGGAATCAGTGG
ATGACCATGGCCAAGGCGTTTTCCGATTTCTACCGTAGCGTATTCCGCCGTGACCGCGGCAGCAACAGTAACAAC
GACAACGACGACGACGACGACAACAACATCAACAACATCAACAACATCAACAACATCAACAACATCAACAACATC
AACAACAACATCAACAACATCAACTCCAGCAACTCAAACTACGCCCCCAACAACGACATCCACACCCGCCTCATG
TCCCGCTACAGCGAAGTCCCAGACTGGTGGTTCCTCGCCATCCTCGCCAGCGCAGTAACCGTATCCATCATCTTC
GTCCGCCTCTACCCCATCGAAACCCCCATCTGGCTCGTCTTCCTCCTCATAGCCATAAACCTCGTCTTCGCCGTC
CCCCTCTCCTTCCTGTCCGCGACGACAGGCACAAACCTCGGCCTCGGCTCCCTCATCCAGATCATCACCGGCTAC
CTCCTTCCCGGCAACCCCAACGCCTTTCTCTTCGGTCAGACGCTCGGCTCCTGGGCTCTGGCTGGCTACGGTGAC
AACTACGTGCAGGATCAGAAGATGGCCCATTACTGTCGGATCGCGCCCCGGGCCGTCTTTCGTAGCCAGATGAGT
ACCATCTTCGTCACCTGCTTCGTCGCCGTCGCCACGCAGCACCTCATCCTCTCTCGGGTTCCAGCTCTCTGCACG
CCTACACAGCCGAGCCGCTTCACCTGTGCGGCAGACGGGGCGCCTCTGTACGCCAGCTCGCTCATGTGGGGAGTC
CTGGGCTCTCACCGAATGTTCGCATCTTTATACCCGCTGCTAAAGTGGTGCTTCCTCATGGGAGCCGTCATCGCT
CTCCTGTTCCTCGTCGGCCAGGGTCTGGGACCACGATACCTTCCTCCCATCCGACAACGACTCCAATCCTCACTC
CCTCCCCACGTCTTCTCGGCCCTCGACCGCACCGTCTTCCCACTCATAGCCTCGATGCTCTGGCTCAACCCCGTA
CTCGTCATCCAGGGCATCCAACACTGGGCCCCCTCCAACCTCGCCTTCAAAACACCCGGCATGCTCCTATCCCTC
ATCTTCATGTACTGGCTCCCGCGCCGCAAGCCAGCCTGGTGGACACGCTACAACTACACCCTCTCCGCCGCCCTG
ACAGCCGGTCTCGCCCTCAGCGCCCTCGTCATCTTCTTCGCCCTCGGCTTCCACCCCGTGAAGCTCTCCTGGTGG
GGCAACCGCGTCAGCGCCGCCGGCGTCGACGGCTCCACTGTCGGACTCCTCCCGCTTCCGGCCCGTGGATACTTT
GGTCCGGACCGGGAACGTTTCCCTAGGCCCCACTCCGGATCCGTTCCCCGTTCGGCTCCCCACCAAACGGCCGGA
ACAAGCCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail