Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05276
Gene name
Locationscaffold_05:3081131..3082238
Strand+
Gene length (bp)1107
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16035 Chalcone_2 Chalcone isomerase like 1.3E-72 148 349

GO

GO Term Description Terminal node
GO:0016872 intramolecular lyase activity Yes
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 55 74 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05276
MPRLQPSLLARPRKCPFLPLPSRRTLFDNQTARATQHLDVQKLHSKRRDYERHRTAFLAAGAAAGIMSFVYTAWK
LKQTLEANELRADSVPGETFKVEAGEKRKVVIIDEKGREIVPTGDAVVPAFPRTMVVKVDMTEGQGEGADGVDFT
LVGLGMRSVTFLGFRVYLVGFYVATSDVARLQQYLIRKINPLATTLIPSEKEALRKALLDATEGEETWDTVLREA
GCRTAFRVMPVRDTDFHHLRDGFVRAIQTRSKRDEAFHDDDFGVAMERFRAMFNRGKMNKTQELLLLRGANGKLS
VLHGDGRLEREAEREVVGVVEDERLSRLLWLNYLAGKQVASEPARRNIIEGVMEFVTRPVGTVAAQVV*
Coding >Ophcf2|05276
ATGCCTCGACTCCAGCCCTCGCTCCTCGCCCGACCCCGAAAATGTCCCTTCCTCCCTCTGCCCTCGCGCCGAACC
CTCTTCGACAACCAGACAGCGCGAGCGACGCAACACCTCGACGTCCAGAAGCTGCACTCGAAGAGGCGCGACTAC
GAGCGGCACCGAACGGCCTTTCTCGCTGCCGGCGCGGCGGCGGGAATCATGTCTTTCGTCTACACGGCTTGGAAA
CTCAAGCAGACGCTCGAGGCGAATGAGCTCCGGGCCGATTCCGTGCCGGGGGAGACGTTCAAGGTCGAGGCCGGG
GAGAAGCGCAAGGTGGTGATTATCGACGAGAAAGGGAGGGAGATTGTGCCGACTGGTGATGCCGTCGTTCCGGCT
TTCCCGCGGACCATGGTGGTTAAGGTTGACATGACCGAGGGTCAAGGTGAGGGTGCGGATGGGGTCGACTTTACG
CTCGTCGGGCTGGGGATGCGGTCCGTCACCTTCCTGGGGTTTCGCGTTTACCTCGTCGGCTTTTACGTTGCTACG
TCGGACGTTGCCAGACTGCAGCAGTATCTCATCCGAAAGATCAACCCGCTCGCCACGACGCTCATCCCATCGGAG
AAGGAGGCTCTTCGCAAGGCGCTGCTTGACGCTACGGAGGGAGAGGAGACGTGGGATACGGTGCTCAGGGAGGCC
GGGTGTCGGACTGCCTTTCGCGTCATGCCCGTTCGCGATACCGACTTTCATCACCTGCGCGACGGGTTCGTCAGG
GCGATTCAGACGCGGTCGAAGCGCGACGAGGCTTTTCACGACGACGACTTTGGCGTCGCCATGGAGAGGTTCAGG
GCCATGTTCAACCGGGGGAAGATGAACAAGACGCAGGAGCTTTTGCTGCTTCGAGGCGCGAATGGGAAGCTTTCC
GTCTTGCATGGTGATGGGAGGCTCGAGAGGGAGGCGGAGAGGGAGGTCGTGGGGGTTGTCGAGGACGAGCGTCTT
TCGCGCTTGCTTTGGCTGAATTACCTGGCCGGGAAGCAGGTTGCCTCTGAACCGGCGAGACGGAACATTATTGAG
GGGGTTATGGAGTTTGTGACGAGGCCTGTCGGGACTGTTGCTGCGCAGGTTGTATGA
Transcript >Ophcf2|05276
ATGCCTCGACTCCAGCCCTCGCTCCTCGCCCGACCCCGAAAATGTCCCTTCCTCCCTCTGCCCTCGCGCCGAACC
CTCTTCGACAACCAGACAGCGCGAGCGACGCAACACCTCGACGTCCAGAAGCTGCACTCGAAGAGGCGCGACTAC
GAGCGGCACCGAACGGCCTTTCTCGCTGCCGGCGCGGCGGCGGGAATCATGTCTTTCGTCTACACGGCTTGGAAA
CTCAAGCAGACGCTCGAGGCGAATGAGCTCCGGGCCGATTCCGTGCCGGGGGAGACGTTCAAGGTCGAGGCCGGG
GAGAAGCGCAAGGTGGTGATTATCGACGAGAAAGGGAGGGAGATTGTGCCGACTGGTGATGCCGTCGTTCCGGCT
TTCCCGCGGACCATGGTGGTTAAGGTTGACATGACCGAGGGTCAAGGTGAGGGTGCGGATGGGGTCGACTTTACG
CTCGTCGGGCTGGGGATGCGGTCCGTCACCTTCCTGGGGTTTCGCGTTTACCTCGTCGGCTTTTACGTTGCTACG
TCGGACGTTGCCAGACTGCAGCAGTATCTCATCCGAAAGATCAACCCGCTCGCCACGACGCTCATCCCATCGGAG
AAGGAGGCTCTTCGCAAGGCGCTGCTTGACGCTACGGAGGGAGAGGAGACGTGGGATACGGTGCTCAGGGAGGCC
GGGTGTCGGACTGCCTTTCGCGTCATGCCCGTTCGCGATACCGACTTTCATCACCTGCGCGACGGGTTCGTCAGG
GCGATTCAGACGCGGTCGAAGCGCGACGAGGCTTTTCACGACGACGACTTTGGCGTCGCCATGGAGAGGTTCAGG
GCCATGTTCAACCGGGGGAAGATGAACAAGACGCAGGAGCTTTTGCTGCTTCGAGGCGCGAATGGGAAGCTTTCC
GTCTTGCATGGTGATGGGAGGCTCGAGAGGGAGGCGGAGAGGGAGGTCGTGGGGGTTGTCGAGGACGAGCGTCTT
TCGCGCTTGCTTTGGCTGAATTACCTGGCCGGGAAGCAGGTTGCCTCTGAACCGGCGAGACGGAACATTATTGAG
GGGGTTATGGAGTTTGTGACGAGGCCTGTCGGGACTGTTGCTGCGCAGGTTGTATGA
Gene >Ophcf2|05276
ATGCCTCGACTCCAGCCCTCGCTCCTCGCCCGACCCCGAAAATGTCCCTTCCTCCCTCTGCCCTCGCGCCGAACC
CTCTTCGACAACCAGACAGCGCGAGCGACGCAACACCTCGACGTCCAGAAGCTGCACTCGAAGAGGCGCGACTAC
GAGCGGCACCGAACGGCCTTTCTCGCTGCCGGCGCGGCGGCGGGAATCATGTCTTTCGTCTACACGGCTTGGAAA
CTCAAGCAGACGCTCGAGGCGAATGAGCTCCGGGCCGATTCCGTGCCGGGGGAGACGTTCAAGGTCGAGGCCGGG
GAGAAGCGCAAGGTGGTGATTATCGACGAGAAAGGGAGGGAGATTGTGCCGACTGGTGATGCCGTCGTTCCGGCT
TTCCCGCGGACCATGGTGGTTAAGGTTGACATGACCGAGGGTCAAGGTGAGGGTGCGGATGGGGTCGACTTTACG
CTCGTCGGGCTGGGGATGCGGTCCGTCACCTTCCTGGGGTTTCGCGTTTACCTCGTCGGCTTTTACGTTGCTACG
TCGGACGTTGCCAGACTGCAGCAGTATCTCATCCGAAAGATCAACCCGCTCGCCACGACGCTCATCCCATCGGAG
AAGGAGGCTCTTCGCAAGGCGCTGCTTGACGCTACGGAGGGAGAGGAGACGTGGGATACGGTGCTCAGGGAGGCC
GGGTGTCGGACTGCCTTTCGCGTCATGCCCGTTCGCGATACCGACTTTCATCACCTGCGCGACGGGTTCGTCAGG
GCGATTCAGACGCGGTCGAAGCGCGACGAGGCTTTTCACGACGACGACTTTGGCGTCGCCATGGAGAGGTTCAGG
GCCATGTTCAACCGGGGGAAGATGAACAAGACGCAGGAGCTTTTGCTGCTTCGAGGCGCGAATGGGAAGCTTTCC
GTCTTGCATGGTGATGGGAGGCTCGAGAGGGAGGCGGAGAGGGAGGTCGTGGGGGTTGTCGAGGACGAGCGTCTT
TCGCGCTTGCTTTGGCTGAATTACCTGGCCGGGAAGCAGGTTGCCTCTGAACCGGCGAGACGGAACATTATTGAG
GGGGTTATGGAGTTTGTGACGAGGCCTGTCGGGACTGTTGCTGCGCAGGTTGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail