Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05274
Gene name
Locationscaffold_05:3074018..3077043
Strand+
Gene length (bp)3025
Transcript length (bp)2967
Coding sequence length (bp)2967
Protein length (aa) 989

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 5.2E-80 614 916
PF16486 ArgoN N-terminal domain of argonaute 2.0E-18 92 233
PF08699 ArgoL1 Argonaute linker 1 domain 1.1E-13 243 300
PF16488 ArgoL2 Argonaute linker 2 domain 7.5E-12 468 512
PF02170 PAZ PAZ domain 4.8E-09 351 458

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6537 0.5533 0.4104 0.0546 0.0876 0.0156 0.0794 0.0962 0.073 0.0234

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup860
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3044
Ophiocordyceps australis map64 (Brazil) OphauB2|2045
Ophiocordyceps camponoti-floridani Ophcf2|05274 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3281
Ophiocordyceps camponoti-rufipedis Ophun1|4302
Ophiocordyceps kimflemingae Ophio5|1233
Ophiocordyceps subramaniannii Hirsu2|48

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05274
MKQVHKMSDRGRSPPPPAGSRGASPTRSASGSQPGAAGGRVVPLGFDPAKPANKPDNKGNTRMELPADAYVADTQ
KSIFALRGNKLNTEGKPAIIEVNQYRMKTFDFSKKIYQYDVTISPDLDRKAVVLKKIWSHNATKQALSKYKFEAW
LFDGRKLAWAPAQVDRGEVRYQVDLDEGRKPPASGSRKENNRFFVNIRQTTVVSMSALQGYLQQKISFNTSVQTA
MNFIDHLLRQQPSQRLLSIKRNFYDQEQRGKPLSAVGSYIEAHKGLYASVRLSQNLSLGGMGLALNADVANTCFW
VGLPMEQLMINFLGACERKWTGLTPVTAVQHLKPVKHHSGSWASSDAFKQLRKLRRLKFTVRHPNRVNTEKLYTI
VDFAFKPEYGPDGGNAKNVTFDYEGGKISVENFFAKKYKAHLRYSLLPVIDAGKNGYIPMEFAVVAPMQRYPFKL
NPDQTSAMIKFAVTRPRERRADIERGVASLRFNEDPYLREYGVKFEPSFTKVEAKILPPPRVDFGTGNADPKFSG
RWDLRGKKFWKQNLAPLENWAFIVLDGCVDFNSLQAFAKSFRQAFLSHGGKCPADALLLNVPANFKHNAAEALAW
AHNEIKSKRGYTQLIFVVVAHKNSPHYERLKKSADCRFGILSQVVNGDHVKKNNGQYQSNVAMKVNAKLGGATSR
TMPPWKSQTFFPKDRPTMMVGVDVSHGAPGSNAPSTAAMTMSVDRDATRYAAMVETNGFRVEILTAANVHFLFGQ
LADEWKKGHEGAFPKHIVYFRDGVSEGQFSQVLDQEISEIRCFFRSKAPQMPMPKFTVVVATKRHHIRFFPGQGD
KNGNALPGTLVEKEVTHPFMWDYYMCSHVAIQGTARPVHYHVILDEMNVPVNDFQKMIYHQCYSYARSTTPVSLH
PAVYYAHLAGARARAHENIATSEGFRSGAKGHEMIRDQVAKGATMGSIPSGTESPALLTLGGRVNPDKGPEPGEQ
RQRDFFRSTMWYI*
Coding >Ophcf2|05274
ATGAAACAGGTTCACAAAATGTCCGACAGAGGCCGTTCGCCTCCTCCGCCTGCGGGCAGCCGGGGAGCATCGCCG
ACTCGCTCTGCCTCGGGCTCTCAGCCTGGGGCAGCGGGTGGACGAGTCGTTCCTCTGGGCTTTGATCCAGCCAAG
CCGGCCAACAAGCCGGACAACAAGGGCAACACTCGCATGGAACTCCCGGCCGATGCCTACGTTGCCGACACTCAG
AAGAGCATCTTTGCTCTTCGCGGAAACAAGTTGAACACCGAGGGCAAGCCTGCCATCATAGAGGTGAACCAATAT
CGCATGAAGACTTTTGACTTCAGCAAGAAGATTTACCAGTACGACGTGACCATCTCGCCGGACTTGGACAGGAAG
GCTGTAGTCCTTAAGAAGATTTGGTCGCACAACGCGACGAAGCAGGCTCTTTCCAAGTACAAGTTCGAGGCCTGG
CTCTTTGATGGCCGGAAACTTGCCTGGGCGCCTGCTCAGGTTGACCGCGGCGAGGTCCGCTATCAGGTCGACTTG
GACGAGGGTCGCAAGCCTCCAGCCAGCGGTAGCCGCAAGGAAAATAACCGCTTCTTCGTCAATATTCGCCAGACT
ACCGTGGTCAGCATGTCGGCCCTTCAGGGATATCTTCAGCAGAAGATATCCTTCAACACAAGCGTACAGACCGCC
ATGAACTTCATTGACCACTTGCTGCGCCAGCAGCCGTCGCAGCGCCTCTTGTCCATCAAGAGAAATTTTTACGAC
CAGGAGCAGAGGGGCAAGCCCTTGTCGGCCGTGGGCAGCTACATTGAAGCACACAAGGGACTGTACGCCTCGGTC
CGCCTAAGCCAGAACCTTTCACTGGGCGGCATGGGCCTCGCCCTCAATGCGGATGTGGCCAATACATGCTTCTGG
GTTGGGCTTCCTATGGAGCAGCTCATGATCAACTTCTTGGGCGCTTGCGAGCGCAAGTGGACCGGCTTGACTCCC
GTCACTGCCGTCCAGCACCTCAAGCCTGTCAAACATCACAGCGGTTCCTGGGCATCTTCTGATGCCTTCAAACAG
CTTCGAAAGCTCAGACGTCTAAAGTTCACTGTCCGCCACCCTAACAGGGTCAATACGGAAAAGCTGTACACCATC
GTTGATTTCGCTTTCAAGCCTGAATACGGTCCCGACGGCGGCAACGCCAAGAATGTGACATTCGACTACGAGGGT
GGCAAGATCTCGGTCGAAAACTTCTTCGCCAAAAAGTACAAGGCACATCTTCGCTACTCGTTGCTGCCCGTCATC
GACGCTGGGAAGAATGGGTACATCCCCATGGAGTTTGCCGTCGTGGCCCCCATGCAGCGATACCCCTTCAAGCTC
AACCCGGATCAGACGTCGGCGATGATCAAGTTTGCCGTGACGCGTCCCCGCGAACGTCGAGCCGACATCGAGCGT
GGCGTGGCGTCCCTGCGCTTCAACGAGGACCCCTACCTCAGGGAATATGGCGTCAAGTTCGAGCCATCCTTCACA
AAGGTCGAGGCCAAGATCTTACCTCCGCCTCGCGTCGATTTCGGCACAGGCAACGCCGATCCCAAGTTCTCGGGC
CGCTGGGATCTTCGCGGCAAGAAATTCTGGAAGCAGAACCTGGCTCCCCTGGAGAACTGGGCCTTCATCGTGCTC
GACGGCTGCGTCGATTTCAACTCCCTTCAGGCCTTTGCCAAGTCGTTTCGACAGGCCTTCCTCAGCCATGGAGGC
AAGTGTCCGGCTGACGCTCTGCTGCTCAACGTGCCAGCCAATTTTAAACACAACGCCGCTGAGGCTCTCGCCTGG
GCCCATAATGAGATCAAGTCCAAGCGTGGCTACACGCAACTCATCTTCGTCGTCGTGGCCCACAAGAACAGCCCG
CACTACGAGCGACTCAAGAAGTCGGCTGACTGCCGCTTCGGCATCTTGTCGCAGGTGGTCAACGGCGACCACGTC
AAGAAGAACAATGGCCAGTACCAGTCCAACGTGGCCATGAAGGTCAACGCCAAGCTCGGAGGCGCCACGTCGCGC
ACGATGCCTCCCTGGAAGAGTCAGACCTTCTTCCCCAAGGACCGGCCGACGATGATGGTTGGCGTCGACGTTTCG
CACGGCGCTCCGGGTAGCAACGCGCCCTCGACGGCGGCCATGACCATGTCGGTTGACCGTGACGCGACGCGATAC
GCTGCCATGGTGGAGACCAACGGTTTCCGCGTCGAGATTCTCACGGCGGCAAACGTCCACTTCCTATTTGGACAG
CTCGCCGACGAGTGGAAGAAGGGACACGAAGGCGCCTTTCCCAAGCACATTGTTTACTTCCGAGATGGCGTCTCC
GAGGGACAGTTTTCGCAAGTTCTCGACCAGGAGATCTCCGAGATACGATGCTTCTTCAGGTCTAAGGCGCCCCAG
ATGCCCATGCCCAAGTTCACCGTTGTGGTGGCCACCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGAC
AAGAACGGCAACGCGCTTCCGGGCACTCTCGTGGAGAAGGAGGTCACTCACCCCTTCATGTGGGATTACTACATG
TGCTCCCACGTGGCCATCCAGGGCACGGCACGCCCTGTGCACTATCATGTCATTCTCGATGAGATGAACGTTCCC
GTGAATGACTTCCAAAAGATGATCTACCATCAGTGCTACAGCTACGCGAGATCGACGACGCCCGTTTCCCTGCAC
CCGGCCGTCTACTACGCACATCTGGCCGGAGCGCGGGCTCGGGCCCACGAGAACATTGCCACGTCGGAGGGGTTC
CGATCCGGAGCCAAGGGTCACGAGATGATCCGCGACCAGGTGGCCAAGGGGGCCACCATGGGCAGCATCCCCAGC
GGGACCGAGTCTCCTGCCCTTTTGACGCTGGGTGGAAGAGTGAACCCGGACAAGGGCCCGGAACCTGGCGAGCAG
CGACAGCGGGACTTCTTCCGCAGTACCATGTGGTACATTTAA
Transcript >Ophcf2|05274
ATGAAACAGGTTCACAAAATGTCCGACAGAGGCCGTTCGCCTCCTCCGCCTGCGGGCAGCCGGGGAGCATCGCCG
ACTCGCTCTGCCTCGGGCTCTCAGCCTGGGGCAGCGGGTGGACGAGTCGTTCCTCTGGGCTTTGATCCAGCCAAG
CCGGCCAACAAGCCGGACAACAAGGGCAACACTCGCATGGAACTCCCGGCCGATGCCTACGTTGCCGACACTCAG
AAGAGCATCTTTGCTCTTCGCGGAAACAAGTTGAACACCGAGGGCAAGCCTGCCATCATAGAGGTGAACCAATAT
CGCATGAAGACTTTTGACTTCAGCAAGAAGATTTACCAGTACGACGTGACCATCTCGCCGGACTTGGACAGGAAG
GCTGTAGTCCTTAAGAAGATTTGGTCGCACAACGCGACGAAGCAGGCTCTTTCCAAGTACAAGTTCGAGGCCTGG
CTCTTTGATGGCCGGAAACTTGCCTGGGCGCCTGCTCAGGTTGACCGCGGCGAGGTCCGCTATCAGGTCGACTTG
GACGAGGGTCGCAAGCCTCCAGCCAGCGGTAGCCGCAAGGAAAATAACCGCTTCTTCGTCAATATTCGCCAGACT
ACCGTGGTCAGCATGTCGGCCCTTCAGGGATATCTTCAGCAGAAGATATCCTTCAACACAAGCGTACAGACCGCC
ATGAACTTCATTGACCACTTGCTGCGCCAGCAGCCGTCGCAGCGCCTCTTGTCCATCAAGAGAAATTTTTACGAC
CAGGAGCAGAGGGGCAAGCCCTTGTCGGCCGTGGGCAGCTACATTGAAGCACACAAGGGACTGTACGCCTCGGTC
CGCCTAAGCCAGAACCTTTCACTGGGCGGCATGGGCCTCGCCCTCAATGCGGATGTGGCCAATACATGCTTCTGG
GTTGGGCTTCCTATGGAGCAGCTCATGATCAACTTCTTGGGCGCTTGCGAGCGCAAGTGGACCGGCTTGACTCCC
GTCACTGCCGTCCAGCACCTCAAGCCTGTCAAACATCACAGCGGTTCCTGGGCATCTTCTGATGCCTTCAAACAG
CTTCGAAAGCTCAGACGTCTAAAGTTCACTGTCCGCCACCCTAACAGGGTCAATACGGAAAAGCTGTACACCATC
GTTGATTTCGCTTTCAAGCCTGAATACGGTCCCGACGGCGGCAACGCCAAGAATGTGACATTCGACTACGAGGGT
GGCAAGATCTCGGTCGAAAACTTCTTCGCCAAAAAGTACAAGGCACATCTTCGCTACTCGTTGCTGCCCGTCATC
GACGCTGGGAAGAATGGGTACATCCCCATGGAGTTTGCCGTCGTGGCCCCCATGCAGCGATACCCCTTCAAGCTC
AACCCGGATCAGACGTCGGCGATGATCAAGTTTGCCGTGACGCGTCCCCGCGAACGTCGAGCCGACATCGAGCGT
GGCGTGGCGTCCCTGCGCTTCAACGAGGACCCCTACCTCAGGGAATATGGCGTCAAGTTCGAGCCATCCTTCACA
AAGGTCGAGGCCAAGATCTTACCTCCGCCTCGCGTCGATTTCGGCACAGGCAACGCCGATCCCAAGTTCTCGGGC
CGCTGGGATCTTCGCGGCAAGAAATTCTGGAAGCAGAACCTGGCTCCCCTGGAGAACTGGGCCTTCATCGTGCTC
GACGGCTGCGTCGATTTCAACTCCCTTCAGGCCTTTGCCAAGTCGTTTCGACAGGCCTTCCTCAGCCATGGAGGC
AAGTGTCCGGCTGACGCTCTGCTGCTCAACGTGCCAGCCAATTTTAAACACAACGCCGCTGAGGCTCTCGCCTGG
GCCCATAATGAGATCAAGTCCAAGCGTGGCTACACGCAACTCATCTTCGTCGTCGTGGCCCACAAGAACAGCCCG
CACTACGAGCGACTCAAGAAGTCGGCTGACTGCCGCTTCGGCATCTTGTCGCAGGTGGTCAACGGCGACCACGTC
AAGAAGAACAATGGCCAGTACCAGTCCAACGTGGCCATGAAGGTCAACGCCAAGCTCGGAGGCGCCACGTCGCGC
ACGATGCCTCCCTGGAAGAGTCAGACCTTCTTCCCCAAGGACCGGCCGACGATGATGGTTGGCGTCGACGTTTCG
CACGGCGCTCCGGGTAGCAACGCGCCCTCGACGGCGGCCATGACCATGTCGGTTGACCGTGACGCGACGCGATAC
GCTGCCATGGTGGAGACCAACGGTTTCCGCGTCGAGATTCTCACGGCGGCAAACGTCCACTTCCTATTTGGACAG
CTCGCCGACGAGTGGAAGAAGGGACACGAAGGCGCCTTTCCCAAGCACATTGTTTACTTCCGAGATGGCGTCTCC
GAGGGACAGTTTTCGCAAGTTCTCGACCAGGAGATCTCCGAGATACGATGCTTCTTCAGGTCTAAGGCGCCCCAG
ATGCCCATGCCCAAGTTCACCGTTGTGGTGGCCACCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGAC
AAGAACGGCAACGCGCTTCCGGGCACTCTCGTGGAGAAGGAGGTCACTCACCCCTTCATGTGGGATTACTACATG
TGCTCCCACGTGGCCATCCAGGGCACGGCACGCCCTGTGCACTATCATGTCATTCTCGATGAGATGAACGTTCCC
GTGAATGACTTCCAAAAGATGATCTACCATCAGTGCTACAGCTACGCGAGATCGACGACGCCCGTTTCCCTGCAC
CCGGCCGTCTACTACGCACATCTGGCCGGAGCGCGGGCTCGGGCCCACGAGAACATTGCCACGTCGGAGGGGTTC
CGATCCGGAGCCAAGGGTCACGAGATGATCCGCGACCAGGTGGCCAAGGGGGCCACCATGGGCAGCATCCCCAGC
GGGACCGAGTCTCCTGCCCTTTTGACGCTGGGTGGAAGAGTGAACCCGGACAAGGGCCCGGAACCTGGCGAGCAG
CGACAGCGGGACTTCTTCCGCAGTACCATGTGGTACATTTAA
Gene >Ophcf2|05274
ATGAAACAGGTTCACAAAATGTCCGACAGAGGCCGTTCGCCTCCTCCGCCTGCGGGCAGCCGGGGAGCATCGCCG
ACTCGCTCTGCCTCGGGCTCTCAGCCTGGGGCAGCGGGTGGACGAGTCGTTCCTCTGGGCTTTGATCCAGCCAAG
CCGGCCAACAAGCCGGACAACAAGGGCAACACTCGCATGGAACTCCCGGCCGATGCCTACGTTGCCGACACTCAG
AAGAGCATCTTTGCTCTTCGCGGAAACAAGTTGAACACCGAGGGCAAGCCTGCCATCATAGAGGTGAACCAATAT
CGCATGAAGACTTTTGACTTCAGCAAGAAGATTTACCAGTACGACGTGAGTATCTCCCTGCATATCCCCTCCTGT
GTCCCGGCTGGAGCTCACATGATTGCAGGTGACCATCTCGCCGGACTTGGACAGGAAGGCTGTAGTCCTTAAGAA
GATTTGGTCGCACAACGCGACGAAGCAGGCTCTTTCCAAGTACAAGTTCGAGGCCTGGCTCTTTGATGGCCGGAA
ACTTGCCTGGGCGCCTGCTCAGGTTGACCGCGGCGAGGTCCGCTATCAGGTCGACTTGGACGAGGGTCGCAAGCC
TCCAGCCAGCGGTAGCCGCAAGGAAAATAACCGCTTCTTCGTCAATATTCGCCAGACTACCGTGGTCAGCATGTC
GGCCCTTCAGGGATATCTTCAGCAGAAGATATCCTTCAACACAAGCGTACAGACCGCCATGAACTTCATTGACCA
CTTGCTGCGCCAGCAGCCGTCGCAGCGCCTCTTGTCCATCAAGAGAAATTTTTACGACCAGGAGCAGAGGGGCAA
GCCCTTGTCGGCCGTGGGCAGCTACATTGAAGCACACAAGGGACTGTACGCCTCGGTCCGCCTAAGCCAGAACCT
TTCACTGGGCGGCATGGGCCTCGCCCTCAATGCGGATGTGGCCAATACATGCTTCTGGGTTGGGCTTCCTATGGA
GCAGCTCATGATCAACTTCTTGGGCGCTTGCGAGCGCAAGTGGACCGGCTTGACTCCCGTCACTGCCGTCCAGCA
CCTCAAGCCTGTCAAACATCACAGCGGTTCCTGGGCATCTTCTGATGCCTTCAAACAGCTTCGAAAGCTCAGACG
TCTAAAGTTCACTGTCCGCCACCCTAACAGGGTCAATACGGAAAAGCTGTACACCATCGTTGATTTCGCTTTCAA
GCCTGAATACGGTCCCGACGGCGGCAACGCCAAGAATGTGACATTCGACTACGAGGGTGGCAAGATCTCGGTCGA
AAACTTCTTCGCCAAAAAGTACAAGGCACATCTTCGCTACTCGTTGCTGCCCGTCATCGACGCTGGGAAGAATGG
GTACATCCCCATGGAGTTTGCCGTCGTGGCCCCCATGCAGCGATACCCCTTCAAGCTCAACCCGGATCAGACGTC
GGCGATGATCAAGTTTGCCGTGACGCGTCCCCGCGAACGTCGAGCCGACATCGAGCGTGGCGTGGCGTCCCTGCG
CTTCAACGAGGACCCCTACCTCAGGGAATATGGCGTCAAGTTCGAGCCATCCTTCACAAAGGTCGAGGCCAAGAT
CTTACCTCCGCCTCGCGTCGATTTCGGCACAGGCAACGCCGATCCCAAGTTCTCGGGCCGCTGGGATCTTCGCGG
CAAGAAATTCTGGAAGCAGAACCTGGCTCCCCTGGAGAACTGGGCCTTCATCGTGCTCGACGGCTGCGTCGATTT
CAACTCCCTTCAGGCCTTTGCCAAGTCGTTTCGACAGGCCTTCCTCAGCCATGGAGGCAAGTGTCCGGCTGACGC
TCTGCTGCTCAACGTGCCAGCCAATTTTAAACACAACGCCGCTGAGGCTCTCGCCTGGGCCCATAATGAGATCAA
GTCCAAGCGTGGCTACACGCAACTCATCTTCGTCGTCGTGGCCCACAAGAACAGCCCGCACTACGAGCGACTCAA
GAAGTCGGCTGACTGCCGCTTCGGCATCTTGTCGCAGGTGGTCAACGGCGACCACGTCAAGAAGAACAATGGCCA
GTACCAGTCCAACGTGGCCATGAAGGTCAACGCCAAGCTCGGAGGCGCCACGTCGCGCACGATGCCTCCCTGGAA
GAGTCAGACCTTCTTCCCCAAGGACCGGCCGACGATGATGGTTGGCGTCGACGTTTCGCACGGCGCTCCGGGTAG
CAACGCGCCCTCGACGGCGGCCATGACCATGTCGGTTGACCGTGACGCGACGCGATACGCTGCCATGGTGGAGAC
CAACGGTTTCCGCGTCGAGATTCTCACGGCGGCAAACGTCCACTTCCTATTTGGACAGCTCGCCGACGAGTGGAA
GAAGGGACACGAAGGCGCCTTTCCCAAGCACATTGTTTACTTCCGAGATGGCGTCTCCGAGGGACAGTTTTCGCA
AGTTCTCGACCAGGAGATCTCCGAGATACGATGCTTCTTCAGGTCTAAGGCGCCCCAGATGCCCATGCCCAAGTT
CACCGTTGTGGTGGCCACCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGACAAGAACGGCAACGCGCT
TCCGGGCACTCTCGTGGAGAAGGAGGTCACTCACCCCTTCATGTGGGATTACTACATGTGCTCCCACGTGGCCAT
CCAGGGCACGGCACGCCCTGTGCACTATCATGTCATTCTCGATGAGATGAACGTTCCCGTGAATGACTTCCAAAA
GATGATCTACCATCAGTGCTACAGCTACGCGAGATCGACGACGCCCGTTTCCCTGCACCCGGCCGTCTACTACGC
ACATCTGGCCGGAGCGCGGGCTCGGGCCCACGAGAACATTGCCACGTCGGAGGGGTTCCGATCCGGAGCCAAGGG
TCACGAGATGATCCGCGACCAGGTGGCCAAGGGGGCCACCATGGGCAGCATCCCCAGCGGGACCGAGTCTCCTGC
CCTTTTGACGCTGGGTGGAAGAGTGAACCCGGACAAGGGCCCGGAACCTGGCGAGCAGCGACAGCGGGACTTCTT
CCGCAGTACCATGTGGTACATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail