Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05273
Gene name
Locationscaffold_05:3068716..3071827
Strand+
Gene length (bp)3111
Transcript length (bp)2931
Coding sequence length (bp)2931
Protein length (aa) 977

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05843 Suf Suppressor of forked protein (Suf) 1.6E-84 596 900

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0005634 nucleus Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1855 0.8678 0.3669 0.0103 0.0639 0.0021 0.0432 0.0147 0.0053 0.0162

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2852
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3045
Ophiocordyceps australis map64 (Brazil) OphauB2|2044
Ophiocordyceps camponoti-floridani Ophcf2|05273 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4300
Ophiocordyceps kimflemingae Ophio5|1232
Ophiocordyceps subramaniannii Hirsu2|47

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05273
MATDGEVAWEGEEALAADDAQAQQSDEQVDGAAPDVNVADDDEDADDGADYDPESVAIDVSPQVQESSNASAPQP
RPPAPKPKTSGGFVVEVSDDEDDDENDASPAAVPPIQTRAPPVKNGLSPAPRADNPLPVGPQMVPRLDAVTLLEA
RIQDDQRGDMDAWLSLIAEHKRRNRLEELRHVYRRFLLVFPQAADIWVEWIEMELDLDNFVEAERLFGQSLMSVL
NVKLWTIYLNYIRRRNDLTNDPAGNGRRTVAQSYDFVIDNIGVDRDSGNIWQDYISFIKSGPGQVGGTGWQDQQK
MDQLRKAYQRAINVPMLTVNTMWREYDQFEMGLNKVTGRKFIQEKSPGYMSAKSANIALDNMARSLKRINLPRLP
PVPGFDGDQEFRHQVEMWKKWVAWEKDDPLVLKDDEPQAYKQRVLYCYRQALMALRFWPEMWVDAATWCLDNDVR
DAENKPVGTDLLLQGIAANPESVLLAFKHADHIEVNYPEKEGDRSAYAKAVRQPYDTVLETLYRMGDKVKEREKL
EVSAVRAAATLDPSMQESIESADYDDYDDDDDDDDDDEAVKKPKKSPTEERIIAIQEAHAAESQLLSRTISYVWI
ALARAMRRIQGKGSQSEGGLRKVFTDARQKGRLTSDVYVAVALLESVVYKDPVGSKIFERGARLFPNDENFVIEY
IKFLHSKDDTTNARVVFETCANRLVSNPETRDKARPLYAYFHKYESQYGELSQIAKLEVRMAELFPDDPQLSCFK
SRYSSDRFDPISAPIIVSKAVQMRPKQMLSSLEQQQQQQQQRAYGRSSIPPARRDLSPRPQYVRATASPKRPFGA
DDDDAANPPKRLARGASPLKGAAGRRLDQQRRNQASALHRDITFLLGILPPAHSYDAQRLHSAGLVSLLRDTPLP
DYSTWRAKTGGQVRTPVPMGGRPTTGDLGGGRPLSPYGGRLTSAGGYRSSALPFAEMPPSVWPVLPSGQFGGYRY
M*
Coding >Ophcf2|05273
ATGGCTACTGACGGAGAGGTGGCGTGGGAAGGCGAGGAGGCGCTGGCCGCTGATGATGCCCAGGCTCAGCAGAGC
GACGAACAGGTCGACGGTGCTGCGCCAGATGTCAACGTCGCCGATGACGATGAAGACGCAGATGACGGGGCCGAT
TACGATCCCGAATCTGTCGCCATCGATGTATCCCCTCAAGTCCAAGAAAGCAGTAACGCTTCCGCGCCGCAACCG
AGACCGCCGGCTCCCAAGCCAAAAACCTCGGGAGGTTTCGTTGTCGAAGTCAGCGACGATGAGGATGACGATGAA
AACGACGCGTCGCCGGCTGCGGTGCCACCCATTCAGACTCGGGCCCCTCCCGTCAAGAACGGGCTCTCGCCTGCT
CCCCGGGCCGATAATCCTCTTCCCGTCGGCCCTCAGATGGTCCCCAGGCTGGACGCCGTGACTCTTCTCGAAGCG
CGCATTCAAGACGACCAGCGCGGGGATATGGATGCGTGGCTCAGTCTCATTGCGGAACACAAACGTCGAAACAGG
CTCGAAGAATTGCGCCATGTCTATCGACGTTTTCTTCTGGTCTTTCCACAGGCAGCCGACATCTGGGTAGAGTGG
ATCGAGATGGAGCTCGACCTCGACAACTTTGTAGAGGCTGAACGACTGTTCGGACAGAGCCTCATGTCAGTCCTC
AACGTCAAGCTCTGGACCATCTATCTGAATTACATCCGACGCCGCAACGACCTGACCAACGATCCTGCTGGCAAT
GGGAGACGCACCGTGGCCCAGTCGTACGATTTTGTCATTGACAATATCGGCGTCGATCGGGACTCCGGGAACATC
TGGCAAGACTACATCTCCTTCATCAAGAGCGGTCCTGGCCAGGTCGGCGGCACAGGCTGGCAGGACCAGCAGAAG
ATGGACCAGCTCCGCAAGGCATATCAGCGCGCCATCAATGTTCCCATGTTGACGGTCAACACCATGTGGAGGGAA
TACGACCAGTTCGAGATGGGTCTCAACAAGGTGACGGGTCGAAAATTCATTCAAGAGAAATCGCCAGGGTACATG
TCGGCCAAGAGTGCCAACATTGCGCTCGATAATATGGCACGTTCGCTGAAGAGGATCAACTTACCTCGGCTACCT
CCGGTACCCGGTTTCGACGGGGATCAAGAGTTTCGGCACCAGGTCGAGATGTGGAAGAAGTGGGTTGCGTGGGAG
AAGGATGATCCGCTGGTCCTCAAGGACGACGAGCCTCAGGCGTACAAGCAGAGAGTCCTGTACTGCTACAGGCAG
GCTCTGATGGCTTTACGCTTCTGGCCGGAGATGTGGGTTGACGCGGCCACGTGGTGTCTGGATAACGATGTCCGA
GATGCCGAGAACAAGCCTGTCGGGACGGATCTCCTCCTTCAGGGCATCGCGGCAAACCCGGAGAGCGTGCTGCTG
GCCTTTAAGCACGCCGATCATATCGAGGTCAACTACCCGGAGAAGGAGGGCGACAGGTCCGCGTACGCCAAGGCT
GTCCGTCAGCCGTACGACACGGTGCTGGAGACGCTATACAGGATGGGGGACAAGGTCAAGGAGCGAGAGAAGCTC
GAGGTGAGCGCCGTCAGGGCGGCGGCGACTCTGGACCCGTCGATGCAGGAGTCGATCGAGTCGGCCGACTACGAC
GACTACGACGATGACGACGACGACGACGACGACGACGAAGCAGTGAAGAAGCCCAAGAAGTCGCCCACGGAGGAG
CGCATCATCGCGATCCAGGAAGCGCACGCGGCCGAGTCACAGCTCCTTTCGAGGACCATATCGTACGTCTGGATT
GCCCTGGCTCGAGCCATGCGCCGCATCCAGGGCAAGGGCAGCCAGAGCGAAGGAGGCCTGCGCAAGGTATTCACA
GACGCTCGGCAGAAAGGACGTCTGACGAGCGACGTCTACGTTGCCGTGGCTTTGCTGGAGTCGGTCGTCTACAAG
GATCCCGTCGGATCCAAGATCTTTGAGCGCGGCGCTCGCCTGTTTCCCAACGATGAGAACTTTGTGATAGAGTAC
ATCAAGTTTCTTCATTCCAAGGATGATACGACGAATGCCCGCGTCGTCTTCGAGACGTGCGCAAACAGACTGGTA
TCGAATCCTGAAACGCGGGACAAGGCTAGGCCTTTATACGCCTATTTCCACAAGTACGAGTCGCAGTACGGCGAG
CTCTCGCAGATTGCGAAGCTCGAGGTCCGGATGGCGGAGCTCTTCCCCGACGATCCGCAGCTCAGCTGCTTCAAG
TCTCGCTATTCGTCCGACAGATTCGATCCGATATCGGCGCCCATCATAGTGTCGAAAGCGGTGCAGATGAGGCCG
AAGCAGATGCTTTCGTCGTTGGAGCAGCAGCAGCAGCAGCAGCAGCAACGGGCGTATGGCAGAAGCAGCATCCCA
CCGGCGCGGCGAGATCTGAGCCCGCGACCGCAATACGTGCGAGCGACGGCCTCTCCGAAGCGGCCATTCGGTGCA
GATGACGACGACGCCGCGAACCCTCCCAAGAGGCTTGCTAGGGGAGCCTCTCCTCTGAAGGGGGCTGCGGGACGC
CGTCTGGATCAGCAGCGACGCAACCAGGCGTCGGCACTGCACCGCGACATCACCTTTCTGTTGGGCATCCTGCCG
CCGGCGCACAGCTACGACGCGCAGAGACTACACAGCGCGGGTCTGGTATCGCTGCTGCGCGACACGCCGCTGCCG
GACTACAGCACTTGGAGGGCCAAGACGGGTGGCCAGGTTCGGACGCCGGTGCCCATGGGCGGGCGGCCTACGACG
GGGGATCTGGGGGGCGGCAGGCCTCTGAGTCCGTACGGGGGGCGTCTGACGTCTGCGGGCGGCTACCGAAGCTCT
GCGTTGCCGTTTGCAGAGATGCCGCCGTCAGTGTGGCCTGTGCTGCCGTCGGGGCAGTTTGGCGGCTATCGGTAT
ATGTGA
Transcript >Ophcf2|05273
ATGGCTACTGACGGAGAGGTGGCGTGGGAAGGCGAGGAGGCGCTGGCCGCTGATGATGCCCAGGCTCAGCAGAGC
GACGAACAGGTCGACGGTGCTGCGCCAGATGTCAACGTCGCCGATGACGATGAAGACGCAGATGACGGGGCCGAT
TACGATCCCGAATCTGTCGCCATCGATGTATCCCCTCAAGTCCAAGAAAGCAGTAACGCTTCCGCGCCGCAACCG
AGACCGCCGGCTCCCAAGCCAAAAACCTCGGGAGGTTTCGTTGTCGAAGTCAGCGACGATGAGGATGACGATGAA
AACGACGCGTCGCCGGCTGCGGTGCCACCCATTCAGACTCGGGCCCCTCCCGTCAAGAACGGGCTCTCGCCTGCT
CCCCGGGCCGATAATCCTCTTCCCGTCGGCCCTCAGATGGTCCCCAGGCTGGACGCCGTGACTCTTCTCGAAGCG
CGCATTCAAGACGACCAGCGCGGGGATATGGATGCGTGGCTCAGTCTCATTGCGGAACACAAACGTCGAAACAGG
CTCGAAGAATTGCGCCATGTCTATCGACGTTTTCTTCTGGTCTTTCCACAGGCAGCCGACATCTGGGTAGAGTGG
ATCGAGATGGAGCTCGACCTCGACAACTTTGTAGAGGCTGAACGACTGTTCGGACAGAGCCTCATGTCAGTCCTC
AACGTCAAGCTCTGGACCATCTATCTGAATTACATCCGACGCCGCAACGACCTGACCAACGATCCTGCTGGCAAT
GGGAGACGCACCGTGGCCCAGTCGTACGATTTTGTCATTGACAATATCGGCGTCGATCGGGACTCCGGGAACATC
TGGCAAGACTACATCTCCTTCATCAAGAGCGGTCCTGGCCAGGTCGGCGGCACAGGCTGGCAGGACCAGCAGAAG
ATGGACCAGCTCCGCAAGGCATATCAGCGCGCCATCAATGTTCCCATGTTGACGGTCAACACCATGTGGAGGGAA
TACGACCAGTTCGAGATGGGTCTCAACAAGGTGACGGGTCGAAAATTCATTCAAGAGAAATCGCCAGGGTACATG
TCGGCCAAGAGTGCCAACATTGCGCTCGATAATATGGCACGTTCGCTGAAGAGGATCAACTTACCTCGGCTACCT
CCGGTACCCGGTTTCGACGGGGATCAAGAGTTTCGGCACCAGGTCGAGATGTGGAAGAAGTGGGTTGCGTGGGAG
AAGGATGATCCGCTGGTCCTCAAGGACGACGAGCCTCAGGCGTACAAGCAGAGAGTCCTGTACTGCTACAGGCAG
GCTCTGATGGCTTTACGCTTCTGGCCGGAGATGTGGGTTGACGCGGCCACGTGGTGTCTGGATAACGATGTCCGA
GATGCCGAGAACAAGCCTGTCGGGACGGATCTCCTCCTTCAGGGCATCGCGGCAAACCCGGAGAGCGTGCTGCTG
GCCTTTAAGCACGCCGATCATATCGAGGTCAACTACCCGGAGAAGGAGGGCGACAGGTCCGCGTACGCCAAGGCT
GTCCGTCAGCCGTACGACACGGTGCTGGAGACGCTATACAGGATGGGGGACAAGGTCAAGGAGCGAGAGAAGCTC
GAGGTGAGCGCCGTCAGGGCGGCGGCGACTCTGGACCCGTCGATGCAGGAGTCGATCGAGTCGGCCGACTACGAC
GACTACGACGATGACGACGACGACGACGACGACGACGAAGCAGTGAAGAAGCCCAAGAAGTCGCCCACGGAGGAG
CGCATCATCGCGATCCAGGAAGCGCACGCGGCCGAGTCACAGCTCCTTTCGAGGACCATATCGTACGTCTGGATT
GCCCTGGCTCGAGCCATGCGCCGCATCCAGGGCAAGGGCAGCCAGAGCGAAGGAGGCCTGCGCAAGGTATTCACA
GACGCTCGGCAGAAAGGACGTCTGACGAGCGACGTCTACGTTGCCGTGGCTTTGCTGGAGTCGGTCGTCTACAAG
GATCCCGTCGGATCCAAGATCTTTGAGCGCGGCGCTCGCCTGTTTCCCAACGATGAGAACTTTGTGATAGAGTAC
ATCAAGTTTCTTCATTCCAAGGATGATACGACGAATGCCCGCGTCGTCTTCGAGACGTGCGCAAACAGACTGGTA
TCGAATCCTGAAACGCGGGACAAGGCTAGGCCTTTATACGCCTATTTCCACAAGTACGAGTCGCAGTACGGCGAG
CTCTCGCAGATTGCGAAGCTCGAGGTCCGGATGGCGGAGCTCTTCCCCGACGATCCGCAGCTCAGCTGCTTCAAG
TCTCGCTATTCGTCCGACAGATTCGATCCGATATCGGCGCCCATCATAGTGTCGAAAGCGGTGCAGATGAGGCCG
AAGCAGATGCTTTCGTCGTTGGAGCAGCAGCAGCAGCAGCAGCAGCAACGGGCGTATGGCAGAAGCAGCATCCCA
CCGGCGCGGCGAGATCTGAGCCCGCGACCGCAATACGTGCGAGCGACGGCCTCTCCGAAGCGGCCATTCGGTGCA
GATGACGACGACGCCGCGAACCCTCCCAAGAGGCTTGCTAGGGGAGCCTCTCCTCTGAAGGGGGCTGCGGGACGC
CGTCTGGATCAGCAGCGACGCAACCAGGCGTCGGCACTGCACCGCGACATCACCTTTCTGTTGGGCATCCTGCCG
CCGGCGCACAGCTACGACGCGCAGAGACTACACAGCGCGGGTCTGGTATCGCTGCTGCGCGACACGCCGCTGCCG
GACTACAGCACTTGGAGGGCCAAGACGGGTGGCCAGGTTCGGACGCCGGTGCCCATGGGCGGGCGGCCTACGACG
GGGGATCTGGGGGGCGGCAGGCCTCTGAGTCCGTACGGGGGGCGTCTGACGTCTGCGGGCGGCTACCGAAGCTCT
GCGTTGCCGTTTGCAGAGATGCCGCCGTCAGTGTGGCCTGTGCTGCCGTCGGGGCAGTTTGGCGGCTATCGGTAT
ATGTGA
Gene >Ophcf2|05273
ATGGCTACTGACGGAGAGGTGGCGTGGGAAGGCGAGGAGGCGCTGGCCGCTGATGATGCCCAGGCTCAGCAGAGC
GACGAACAGGTCGACGGTGCTGCGCCAGATGTCAACGTCGCCGATGACGATGAAGACGCAGATGACGGGGCCGAT
TACGATCCCGAATCTGTCGCCATCGATGTATCCCCTCAAGTCCAAGAAAGCAGTAACGCTTCCGCGCCGCAACCG
AGACCGCCGGCTCCCAAGCCAAAAACCTCGGGAGGTTTCGTTGTCGAAGTCAGCGACGATGAGGATGACGATGAA
AACGACGCGTCGCCGGCTGCGGTGCCACCCATTCAGACTCGGGCCCCTCCCGTCAAGAACGGGCTCTCGCCTGCT
CCCCGGGCCGATAATCCTCTTCCCGTCGGCCCTCAGATGGTCCCCAGGCTGGACGCCGTGACTCTTCTCGAAGCG
CGCATTCAAGACGACCAGCGCGGGGATATGGATGCGTGGCTCAGTCTCATTGCGGAACACAAACGTCGAAACAGG
CTCGAAGAATTGCGCCATGTCTATCGACGTTTTCTTCTGGTCTTTCCACAGGCAGTGAGTTGCCCCCCCGCAGCT
AGTCTTTCTTGTCTTTCGAATCGCTGACGCGCTCCATCTCCAGGCCGACATCTGGGTAGAGTGGATCGAGATGGA
GCTCGACCTCGACAACTTTGTAGAGGCTGAACGACTGTTCGGACAGAGCCTCATGTCAGTCCTCAACGTCAAGCT
CTGGACCATCTATCTGAATTACATCCGACGCCGCAACGACCTGACCAACGATCCTGCTGGCAATGGGAGACGCAC
CGTGGCCCAGTCGTACGATTTTGTCATTGACAATATCGGCGTCGATCGGGACTCCGGGAACATCTGGCAAGACTA
CATCTCCTTCATCAAGAGCGGTCCTGGCCAGGTCGGCGGCACAGGCTGGCAGGACCAGCAGAAGATGGACCAGCT
CCGCAAGGCATATCAGCGCGCCATCAATGTTCCCATGTTGACGGTCAACACCATGTGGAGGGAATACGACCAGTT
CGAGATGGGTCTCAACAAGGTGACGGTACGTTGCCCTCTCCTTCTTTGGAACGCAATGTCATCGGTCAACTGACA
TGACTCTCAGGGTCGAAAATTCATTCAAGAGAAATCGCCAGGGTACATGTCGGCCAAGAGTGCCAACATTGCGCT
CGATAATATGGCACGTTCGCTGAAGAGGATCAACTTACCTCGGCTACCTCCGGTACCCGGTTTCGACGGGGATCA
AGAGTTTCGGCACCAGGTCGAGATGTGGAAGAAGTGGGTTGCGTGGGAGAAGGATGATCCGCTGGTCCTCAAGGA
CGACGAGCCTCAGGCGTACAAGCAGAGAGTCCTGTACTGCTACAGGCAGGCTCTGATGGCTTTACGCTTCTGGCC
GGAGATGTGGGTTGACGCGGCCACGTGGTGTCTGGATAACGATGTCCGAGATGCCGAGAACAAGCCTGTCGGGAC
GGATCTCCTCCTTCAGGGCATCGCGGCAAACCCGGAGAGCGTGCTGCTGGCCTTTAAGCACGCCGATCATATCGA
GGTCAACTACCCGGAGAAGGAGGGCGACAGGTCCGCGTACGCCAAGGCTGTCCGTCAGCCGTACGACACGGTGCT
GGAGACGCTATACAGGATGGGGGACAAGGTCAAGGAGCGAGAGAAGCTCGAGGTGAGCGCCGTCAGGGCGGCGGC
GACTCTGGACCCGTCGATGCAGGAGTCGATCGAGTCGGCCGACTACGACGACTACGACGATGACGACGACGACGA
CGACGACGACGAAGCAGTGAAGAAGCCCAAGAAGTCGCCCACGGAGGAGCGCATCATCGCGATCCAGGAAGCGCA
CGCGGCCGAGTCACAGCTCCTTTCGAGGACCATATCGTACGTCTGGATTGCCCTGGCTCGAGCCATGCGCCGCAT
CCAGGGCAAGGGCAGCCAGAGCGAAGGAGGCCTGCGCAAGGTATTCACAGACGCTCGGCAGAAAGGACGTCTGAC
GAGCGACGTCTACGTTGCCGTGGCTTTGCTGGAGTCGGTCGTCTACAAGGATCCCGTCGGATCCAAGATCTTTGA
GCGCGGCGCTCGCCTGTTTCCCAACGATGAGAACTTTGTGATAGAGTACATCAAGTTTCTTCATTCCAAGGATGA
TACGACGAGTTAGTCGATTCCCCCTTCTGCCCGTCCTGGAGACTGCTTGCTGACTGGTGTCAAGATGCCCGCGTC
GTCTTCGAGACGTGCGCAAACAGACTGGTATCGAATCCTGAAACGCGGGACAAGGCTAGGCCTTTATACGCCTAT
TTCCACAAGTACGAGTCGCAGTACGGCGAGCTCTCGCAGATTGCGAAGCTCGAGGTCCGGATGGCGGAGCTCTTC
CCCGACGATCCGCAGCTCAGCTGCTTCAAGTCTCGCTATTCGTCCGACAGATTCGATCCGATATCGGCGCCCATC
ATAGTGTCGAAAGCGGTGCAGATGAGGCCGAAGCAGATGCTTTCGTCGTTGGAGCAGCAGCAGCAGCAGCAGCAG
CAACGGGCGTATGGCAGAAGCAGCATCCCACCGGCGCGGCGAGATCTGAGCCCGCGACCGCAATACGTGCGAGCG
ACGGCCTCTCCGAAGCGGCCATTCGGTGCAGATGACGACGACGCCGCGAACCCTCCCAAGAGGCTTGCTAGGGGA
GCCTCTCCTCTGAAGGGGGCTGCGGGACGCCGTCTGGATCAGCAGCGACGCAACCAGGCGTCGGCACTGCACCGC
GACATCACCTTTCTGTTGGGCATCCTGCCGCCGGCGCACAGCTACGACGCGCAGAGACTACACAGCGCGGGTCTG
GTATCGCTGCTGCGCGACACGCCGCTGCCGGACTACAGCACTTGGAGGGCCAAGACGGGTGGCCAGGTTCGGACG
CCGGTGCCCATGGGCGGGCGGCCTACGACGGGGGATCTGGGGGGCGGCAGGCCTCTGAGTCCGTACGGGGGGCGT
CTGACGTCTGCGGGCGGCTACCGAAGCTCTGCGTTGCCGTTTGCAGAGATGCCGCCGTCAGTGTGGCCTGTGCTG
CCGTCGGGGCAGTTTGGCGGCTATCGGTATATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail