Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05269
Gene name
Locationscaffold_05:3056298..3058195
Strand-
Gene length (bp)1897
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 6.0E-121 41 489
PF13520 AA_permease_2 Amino acid permease 2.9E-31 36 448

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 67 89 22
3 101 123 22
4 143 165 22
5 178 200 22
6 215 237 22
7 264 286 22
8 306 328 22
9 362 384 22
10 388 410 22
11 430 452 22
12 462 481 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.12 0.00 0.33
Alive In ants, during behavior modification 6.80 1.87 11.73
Dead In ants, recently dead 3.56 0.96 6.15

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004983 yes
Alive Dead 0.011615 yes
Dead Fungus 0.004983 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05269
MNGKHDDDAAEKRDDQPADHGEGIVFARSDRLKRSLSARQVQMIAIGGTIGTGLFLGSGKSLAVGGPASMLLCYA
IVGAIVFITMLSLGEMSAFVPVAGSFCSFAGRFVDDAFGFALTWNYWFNDAVSTASDLVALQLLLRYWTVSFPGW
ALSLIFWAVLIAVNVASVRAYGELEYWLSLLKIVAIMAFIVVGIVVNVGGNLDGRYIGGENWRLPGGPFVGGIGG
FASVFVTASFAYGGTESIAITAGETKNPTKTMPRVVKNVFWRILFFYILSILLIGLDVPYTFPGLNSKTTSTSPF
TIVFQMTGAHAAGSVINAVVLSSVLSAGNHALFAAGRLLYTLAIEGHAPSAFARLGANQVPWVAVLASAFVAGLC
FASSFVGAGQLWTWLQNIVGVSNQLSWIAIGIASIRFRSGLARQNKTHLLPFRNWTYPWGPWAVVILNSFLVLVQ
GWSSFSPRFDPVSFVSLYIELPIMLVMYLSWKGWRRTKVVSLAEMDLETDVHTADEDRVDDKAGHWAKRVATWLV
*
Coding >Ophcf2|05269
ATGAACGGGAAACACGACGATGACGCGGCCGAGAAGCGAGACGATCAACCAGCCGATCATGGCGAGGGCATCGTC
TTCGCCCGCTCCGACCGCCTCAAACGCTCGCTCTCGGCGCGACAAGTGCAGATGATTGCCATTGGCGGCACCATC
GGCACCGGCTTGTTCCTCGGATCCGGCAAGTCGTTGGCGGTGGGAGGGCCGGCTTCCATGTTGCTCTGCTACGCC
ATTGTCGGGGCCATCGTCTTCATCACCATGCTGAGCCTGGGCGAGATGTCGGCCTTTGTGCCTGTTGCTGGTAGC
TTTTGCTCTTTTGCGGGCCGTTTTGTTGACGATGCTTTTGGCTTTGCGCTTACTTGGAATTACTGGTTCAACGAC
GCTGTTTCAACCGCCTCGGATCTCGTCGCCTTGCAGCTTCTACTGCGGTACTGGACCGTTAGCTTTCCAGGTTGG
GCATTGAGCCTCATCTTCTGGGCCGTTCTCATCGCCGTAAACGTCGCCAGCGTCCGCGCATACGGCGAGCTCGAA
TATTGGCTTAGCCTTCTCAAGATTGTGGCCATCATGGCCTTCATCGTCGTCGGCATAGTTGTCAATGTCGGGGGT
AACCTCGACGGTCGATATATCGGGGGCGAGAATTGGAGGCTTCCGGGTGGACCTTTTGTTGGGGGGATTGGGGGG
TTCGCGTCGGTGTTTGTGACGGCTTCTTTTGCCTATGGTGGGACTGAGTCCATTGCCATCACCGCTGGGGAGACC
AAGAATCCTACCAAGACGATGCCTCGCGTCGTCAAGAACGTCTTCTGGAGGATCCTCTTCTTCTACATCTTGTCC
ATCCTCCTCATCGGCCTCGACGTCCCCTACACGTTCCCCGGCCTCAACTCCAAGACGACGAGCACATCACCCTTT
ACCATTGTTTTTCAGATGACAGGCGCCCACGCTGCCGGCAGCGTCATCAACGCCGTCGTCTTATCCAGCGTCCTG
TCAGCTGGGAACCATGCCCTCTTCGCCGCTGGACGACTGCTGTACACGCTCGCCATCGAGGGGCATGCGCCGAGC
GCTTTCGCCAGGCTGGGTGCCAATCAGGTGCCGTGGGTGGCGGTGCTGGCCTCGGCTTTTGTTGCTGGCCTTTGC
TTTGCTTCTAGTTTTGTTGGCGCTGGTCAGCTTTGGACTTGGTTGCAGAACATTGTTGGCGTCTCTAATCAGCTC
AGCTGGATTGCCATTGGCATCGCCTCGATACGCTTCCGGTCAGGCCTCGCTCGACAGAACAAGACGCATCTGCTA
CCCTTTCGCAACTGGACCTATCCATGGGGACCATGGGCCGTCGTCATCCTCAATAGTTTTCTTGTGCTCGTTCAG
GGATGGAGCTCCTTCAGTCCCAGGTTTGACCCCGTCAGCTTCGTCAGCTTGTACATTGAGCTGCCCATCATGCTG
GTCATGTATCTGTCCTGGAAGGGCTGGCGACGGACCAAGGTCGTGAGTCTGGCAGAGATGGACCTCGAGACGGAC
GTTCATACGGCGGACGAGGATCGCGTTGATGACAAGGCTGGGCATTGGGCCAAGCGCGTGGCTACCTGGCTGGTT
TGA
Transcript >Ophcf2|05269
ATGAACGGGAAACACGACGATGACGCGGCCGAGAAGCGAGACGATCAACCAGCCGATCATGGCGAGGGCATCGTC
TTCGCCCGCTCCGACCGCCTCAAACGCTCGCTCTCGGCGCGACAAGTGCAGATGATTGCCATTGGCGGCACCATC
GGCACCGGCTTGTTCCTCGGATCCGGCAAGTCGTTGGCGGTGGGAGGGCCGGCTTCCATGTTGCTCTGCTACGCC
ATTGTCGGGGCCATCGTCTTCATCACCATGCTGAGCCTGGGCGAGATGTCGGCCTTTGTGCCTGTTGCTGGTAGC
TTTTGCTCTTTTGCGGGCCGTTTTGTTGACGATGCTTTTGGCTTTGCGCTTACTTGGAATTACTGGTTCAACGAC
GCTGTTTCAACCGCCTCGGATCTCGTCGCCTTGCAGCTTCTACTGCGGTACTGGACCGTTAGCTTTCCAGGTTGG
GCATTGAGCCTCATCTTCTGGGCCGTTCTCATCGCCGTAAACGTCGCCAGCGTCCGCGCATACGGCGAGCTCGAA
TATTGGCTTAGCCTTCTCAAGATTGTGGCCATCATGGCCTTCATCGTCGTCGGCATAGTTGTCAATGTCGGGGGT
AACCTCGACGGTCGATATATCGGGGGCGAGAATTGGAGGCTTCCGGGTGGACCTTTTGTTGGGGGGATTGGGGGG
TTCGCGTCGGTGTTTGTGACGGCTTCTTTTGCCTATGGTGGGACTGAGTCCATTGCCATCACCGCTGGGGAGACC
AAGAATCCTACCAAGACGATGCCTCGCGTCGTCAAGAACGTCTTCTGGAGGATCCTCTTCTTCTACATCTTGTCC
ATCCTCCTCATCGGCCTCGACGTCCCCTACACGTTCCCCGGCCTCAACTCCAAGACGACGAGCACATCACCCTTT
ACCATTGTTTTTCAGATGACAGGCGCCCACGCTGCCGGCAGCGTCATCAACGCCGTCGTCTTATCCAGCGTCCTG
TCAGCTGGGAACCATGCCCTCTTCGCCGCTGGACGACTGCTGTACACGCTCGCCATCGAGGGGCATGCGCCGAGC
GCTTTCGCCAGGCTGGGTGCCAATCAGGTGCCGTGGGTGGCGGTGCTGGCCTCGGCTTTTGTTGCTGGCCTTTGC
TTTGCTTCTAGTTTTGTTGGCGCTGGTCAGCTTTGGACTTGGTTGCAGAACATTGTTGGCGTCTCTAATCAGCTC
AGCTGGATTGCCATTGGCATCGCCTCGATACGCTTCCGGTCAGGCCTCGCTCGACAGAACAAGACGCATCTGCTA
CCCTTTCGCAACTGGACCTATCCATGGGGACCATGGGCCGTCGTCATCCTCAATAGTTTTCTTGTGCTCGTTCAG
GGATGGAGCTCCTTCAGTCCCAGGTTTGACCCCGTCAGCTTCGTCAGCTTGTACATTGAGCTGCCCATCATGCTG
GTCATGTATCTGTCCTGGAAGGGCTGGCGACGGACCAAGGTCGTGAGTCTGGCAGAGATGGACCTCGAGACGGAC
GTTCATACGGCGGACGAGGATCGCGTTGATGACAAGGCTGGGCATTGGGCCAAGCGCGTGGCTACCTGGCTGGTT
TGA
Gene >Ophcf2|05269
ATGAACGGGAAACACGACGATGACGCGGCCGAGAAGCGAGACGATCAACCAGCCGATCATGGCGAGGGCATCGTC
TTCGCCCGCTCCGACCGCCTCAAACGCTCGCTCTCGGCGCGACAAGTGCAGATGATTGCCATTGGCGGCACCATC
GGCACCGGCTTGTTCCTCGGATCCGGCAAGTCGTTGGCGGTGGGAGGGCCGGCTTCCATGTTGCTCTGCTACGCC
ATTGTCGGGGCCATCGTCTTCATCACCATGCTGAGCCTGGGCGAGATGTCGGCCTTTGTGCCTGTTGCTGGTAGC
TTTTGCTCTTTTGCGGGGTGGGTTAGAAGAGAGAGAGAGAGGAGGGGATGATGGAGAGTCGCAGGGGCTGATGTC
GCTTTCAGCCGTTTTGTTGACGATGCTTTTGGCTTTGCGCTTACTTGGAATTACTGGTTCAACGACGCTGTTTCA
ACCGCCTCGGATCTCGTCGCCTTGCAGCTTCTACTGCGGTACTGGACCGTTAGCTTTCCAGGTTGGGCATTGAGC
CTCATCTTCTGGGCCGTTCTCATCGCCGTAAACGTCGCCAGCGTCCGCGCATACGGCGAGCTCGAATATTGGCTT
AGCCTTCTCAAGATTGTGGCCATCATGGTACGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTGAA
CTTGTTGATCGACGGCTGATGTGCCATGCCTTTAGGCCTTCATCGTCGTCGGCATAGTTGTCAATGTCGGGGGTA
ACCTCGACGGTCGATATATCGGGGGCGAGAATTGGAGGCTTCCGGGTGGACCTTTTGTTGGGGGGATTGGGGGGT
TCGCGTCGGTGTTTGTGACGGCTTCTTTTGCCTGTGGGTTGTGGGCTTTCCTCTTTGCTTTCTTTACTGACATGG
TGGTGGTTTGTTTTGCAGATGGTGGGACTGAGTCCATTGCCATCACCGCTGGGGAGACCAAGAATCCTACCAAGA
CGATGCCTCGCGTCGTCAAGAACGTCTTCTGGAGGATCCTCTTCTTCTAGTACGATACGCCCGCTCACATCTCCA
AAACCAGGCTGATGTCAAATGTTTCCAGCATCTTGTCCATCCTCCTCATCGGCCTCGACGTCCCCTACACGTTCC
CCGGCCTCAACTCCAAGACGACGAGCACATCACCCTTTACCATTGTTTTTCAGATGACAGGCGCCCACGCTGCCG
GCAGCGTCATCAACGCCGTCGTCTTATCCAGCGTCCTGTCAGCTGGGAACCATGCCCTCTTCGCCGCTGGACGAC
TGCTGTACACGCTCGCCATCGAGGGGCATGCGCCGAGCGCTTTCGCCAGGCTGGGTGCCAATCAGGTGCCGTGGG
TGGCGGTGCTGGCCTCGGCTTTTGTTGCTGGCCTTTGCTTTGCTTCTAGTTTTGTTGGCGCTGGTCAGCTTTGGA
CTTGGTTGCAGAAGTAGGTCAAAGACCGAGCTCTCTCGGTCGGAAAGGAACTCTGACGGGATTTGACAGCATTGT
TGGCGTCTCTAATCAGCTCAGCTGGATTGCCATTGGCATCGCCTCGATACGCTTCCGGTCAGGCCTCGCTCGACA
GAACAAGACGCATCTGCTACCCTTTCGCAACTGGACCTATCCATGGGGACCATGGGCCGTCGTCATCCTCAATAG
TTTTCTTGTGCTCGTTCAGGGATGGAGCTCCTTCAGTCCCAGGTTTGACCCCGTCAGCTTCGTCAGCTTGTACAT
TGAGCTGCCCATCATGCTGGTCATGTATCTGTCCTGGAAGGGCTGGCGACGGACCAAGGTCGTGAGTCTGGCAGA
GATGGACCTCGAGACGGACGTTCATACGGCGGACGAGGATCGCGTTGATGACAAGGCTGGGCATTGGGCCAAGCG
CGTGGCTACCTGGCTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail