Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05260
Gene name
Locationscaffold_05:2945202..2945932
Strand-
Gene length (bp)730
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08534 Redoxin Redoxin 2.1E-26 30 181
PF00578 AhpC-TSA AhpC/TSA family 7.5E-07 30 139

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016209 antioxidant activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3204 0.2434 0.1397 0.0438 0.7555 0.0321 0.0366 0.0254 0.0535 0.0251

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5772
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2427
Ophiocordyceps australis map64 (Brazil) OphauB2|3683
Ophiocordyceps camponoti-floridani Ophcf2|05260 (this protein)
Ophiocordyceps kimflemingae Ophio5|1973
Ophiocordyceps subramaniannii Hirsu2|9513

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05260
MAFRAALRPVSVVRHVARSFHSTPRACVAVGDRVPTFDGLYEDSPGNKVNLADEFKKADGYIVGVPGAFTGTCST
THVPSYINHAKLKQAGHVFVVSVNDPFVMKAWREQLDPKGASSIRFISDPTAGFTKALELGFDGAAVFGGVRSKR
YALKIEGGKITKTHIEPDVAVADVSMAEKVLA*
Coding >Ophcf2|05260
ATGGCTTTCCGCGCTGCTCTCCGACCCGTGTCTGTCGTCCGTCATGTCGCCCGGAGCTTCCACTCGACGCCCCGA
GCTTGCGTCGCCGTCGGCGATAGAGTGCCCACCTTCGACGGACTCTATGAAGACTCCCCCGGCAACAAGGTGAAC
CTGGCAGACGAGTTCAAGAAAGCCGACGGGTACATCGTTGGCGTTCCAGGGGCCTTTACGGGTACCTGCTCGACC
ACGCACGTCCCATCATACATCAACCATGCCAAGCTAAAGCAGGCCGGCCACGTCTTTGTCGTCTCCGTCAACGAC
CCCTTCGTGATGAAAGCCTGGCGCGAGCAGCTGGATCCAAAGGGCGCGAGCTCGATACGATTCATATCCGATCCG
ACGGCAGGCTTTACCAAGGCTCTCGAACTCGGCTTCGACGGCGCAGCGGTTTTCGGCGGCGTTCGCAGCAAGCGC
TACGCTCTGAAGATCGAGGGCGGAAAGATTACCAAGACGCACATCGAGCCTGACGTGGCTGTCGCCGACGTCTCA
ATGGCCGAAAAGGTGCTGGCATAA
Transcript >Ophcf2|05260
ATGGCTTTCCGCGCTGCTCTCCGACCCGTGTCTGTCGTCCGTCATGTCGCCCGGAGCTTCCACTCGACGCCCCGA
GCTTGCGTCGCCGTCGGCGATAGAGTGCCCACCTTCGACGGACTCTATGAAGACTCCCCCGGCAACAAGGTGAAC
CTGGCAGACGAGTTCAAGAAAGCCGACGGGTACATCGTTGGCGTTCCAGGGGCCTTTACGGGTACCTGCTCGACC
ACGCACGTCCCATCATACATCAACCATGCCAAGCTAAAGCAGGCCGGCCACGTCTTTGTCGTCTCCGTCAACGAC
CCCTTCGTGATGAAAGCCTGGCGCGAGCAGCTGGATCCAAAGGGCGCGAGCTCGATACGATTCATATCCGATCCG
ACGGCAGGCTTTACCAAGGCTCTCGAACTCGGCTTCGACGGCGCAGCGGTTTTCGGCGGCGTTCGCAGCAAGCGC
TACGCTCTGAAGATCGAGGGCGGAAAGATTACCAAGACGCACATCGAGCCTGACGTGGCTGTCGCCGACGTCTCA
ATGGCCGAAAAGGTGCTGGCATAA
Gene >Ophcf2|05260
ATGGCTTTCCGCGCTGCTCTCCGACCCGTGTCTGTCGTCCGTCATGTCGCCCGGAGCTTCCACTCGACGCCCCGA
GCTTGCGTCGCCGTCGGCGATAGAGTGCCCACCTTCGACGGACTCTATGAAGACTCCCCCGGCAACAAGGTGAAC
CTGGCAGACGAGTTCAAGAAAGCCGACGGGTACATCGTTGGCGTTCCAGGGGCCTTTACGGGTACCTGCTCGACC
ACGCACGTCCCATCATACATCAACCATGCCAAGCTAAAGCAGGCCGGCCACGTCTTTGTCGTCTCCGTCAACGAC
CCCTTCGTGTAAGGGTTTAATCATGGCGCTGGGGGGGTCAGAGGATGGTGCTGGCTGACCTGGCACAGGATGAAA
GCCTGGCGCGAGCAGCTGGATCCAAAGGGCGCGAGCTCGGTGGGTGCATCGCGGCGGCTGCCGATACGGGCGTCG
GTAGCTGACAGACGTTGCATATATAGATACGATTCATATCCGATCCGACGGCAGGCTTTACCAAGGCTCTCGAAC
TCGGCTTCGACGGCGCAGCGGTTTTCGGCGGCGTTCGCAGCAAGCGCTACGCTCTGAAGATCGAGGGCGGAAAGA
TTACCAAGACGCACATCGAGCCTGACGTGGCTGTCGCCGACGGTGAGCTATAATCCCGGGTATTTGGGGACGAAG
CGGCTAAGACGTCATTGTACCGGCAGTCTCAATGGCCGAAAAGGTGCTGGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail