Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05248
Gene name
Locationscaffold_05:2914092..2914902
Strand+
Gene length (bp)810
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01871 AMMECR1 AMMECR1 1.8E-44 38 251

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7817 0.3872 0.0564 0.0176 0.5631 0.0186 0.2537 0.1579 0.0671 0.1516

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3779
Ophiocordyceps australis map64 (Brazil) OphauB2|7912
Ophiocordyceps camponoti-floridani Ophcf2|05248 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1986
Ophiocordyceps kimflemingae Ophio5|616
Ophiocordyceps subramaniannii Hirsu2|5548

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05248
MASAEHCLLCFDALEAYLEDRKPLPLDRVQSSWAAFSASASPSVLKDPALRRVAAASSSSSSSSSSSSSQLSTAS
SSSSASPALASTPATSTSSLPLTSSSCPTSTPLFVTWNTVSDGDVCLRGCIGTFESQPLAVGIPEYAVTSAAHDT
RFQPICSAEVPSLQAAVTLLTDFEEANDIHDWQIGTHGIRLSFSDRGRRYGSTYLPDVAVDQGWSKDETIYNLVR
KAGWMGSRSRWKDLDLEVTRYQGKKYVMDYSEYKGWRDWMTATK*
Coding >Ophcf2|05248
ATGGCCTCGGCCGAGCATTGCCTCCTGTGCTTTGACGCACTCGAAGCCTACCTCGAGGACCGCAAGCCCCTTCCC
CTTGACCGCGTCCAGTCATCGTGGGCCGCCTTCTCCGCCTCGGCTTCCCCCTCGGTCCTCAAGGATCCCGCTCTC
CGACGGGTGGCAGCCGCGTCGTCATCCTCGTCGTCCTCGTCATCTTCGTCGTCTTCCCAGCTGTCGACCGCCTCG
TCTTCTTCGTCAGCCTCGCCGGCCCTAGCGTCTACTCCGGCCACGTCCACTTCCTCCCTACCCTTGACGTCGTCC
TCGTGCCCGACTTCGACGCCCCTGTTCGTCACATGGAACACGGTTTCGGACGGCGACGTCTGTCTGCGCGGTTGT
ATCGGAACTTTCGAGTCTCAGCCGCTGGCAGTGGGCATCCCCGAGTACGCCGTCACGTCGGCCGCTCACGATACC
CGCTTCCAGCCCATCTGCAGCGCCGAGGTGCCGTCCCTACAGGCCGCCGTCACCCTTCTCACCGACTTTGAAGAG
GCCAATGATATTCACGACTGGCAGATCGGTACCCACGGCATCCGTCTCTCGTTTTCTGATCGCGGTCGTCGCTAC
GGATCCACCTACTTGCCCGACGTCGCCGTCGATCAGGGCTGGTCCAAGGACGAGACCATCTACAACCTTGTCCGC
AAGGCTGGCTGGATGGGGAGTCGCTCCCGCTGGAAAGATCTTGATCTCGAAGTGACGCGCTACCAAGGCAAGAAA
TACGTCATGGACTACTCAGAGTACAAGGGATGGCGCGACTGGATGACGGCCACCAAGTAG
Transcript >Ophcf2|05248
ATGGCCTCGGCCGAGCATTGCCTCCTGTGCTTTGACGCACTCGAAGCCTACCTCGAGGACCGCAAGCCCCTTCCC
CTTGACCGCGTCCAGTCATCGTGGGCCGCCTTCTCCGCCTCGGCTTCCCCCTCGGTCCTCAAGGATCCCGCTCTC
CGACGGGTGGCAGCCGCGTCGTCATCCTCGTCGTCCTCGTCATCTTCGTCGTCTTCCCAGCTGTCGACCGCCTCG
TCTTCTTCGTCAGCCTCGCCGGCCCTAGCGTCTACTCCGGCCACGTCCACTTCCTCCCTACCCTTGACGTCGTCC
TCGTGCCCGACTTCGACGCCCCTGTTCGTCACATGGAACACGGTTTCGGACGGCGACGTCTGTCTGCGCGGTTGT
ATCGGAACTTTCGAGTCTCAGCCGCTGGCAGTGGGCATCCCCGAGTACGCCGTCACGTCGGCCGCTCACGATACC
CGCTTCCAGCCCATCTGCAGCGCCGAGGTGCCGTCCCTACAGGCCGCCGTCACCCTTCTCACCGACTTTGAAGAG
GCCAATGATATTCACGACTGGCAGATCGGTACCCACGGCATCCGTCTCTCGTTTTCTGATCGCGGTCGTCGCTAC
GGATCCACCTACTTGCCCGACGTCGCCGTCGATCAGGGCTGGTCCAAGGACGAGACCATCTACAACCTTGTCCGC
AAGGCTGGCTGGATGGGGAGTCGCTCCCGCTGGAAAGATCTTGATCTCGAAGTGACGCGCTACCAAGGCAAGAAA
TACGTCATGGACTACTCAGAGTACAAGGGATGGCGCGACTGGATGACGGCCACCAAGTAG
Gene >Ophcf2|05248
ATGGCCTCGGCCGAGCATTGCCTCCTGTGCTTTGACGCACTCGAAGCCTACCTCGAGGACCGCAAGCCCCTTCCC
CTTGACCGCGTCCAGTCATCGTGGGCCGCCTTCTCCGCCTCGGCTTCCCCCTCGGTCCTCAAGGATCCCGCTCTC
CGACGGGTGGCAGCCGCGTCGTCATCCTCGTCGTCCTCGTCATCTTCGTCGTCTTCCCAGCTGTCGACCGCCTCG
TCTTCTTCGTCAGCCTCGCCGGCCCTAGCGTCTACTCCGGCCACGTCCACTTCCTCCCTACCCTTGACGTCGTCC
TCGTGCCCGACTTCGACGCCCCTGTTCGTCACATGGAACACGGTTTCGGACGGCGACGTCTGTCTGCGCGGTTGT
ATCGGAACTTTCGAGTCTCAGCCGCTGGCAGTGGGCATCCCCGAGTACGCCGTCACGTCGGCCGCTCACGATACC
CGCTTCCAGCCCATCTGCAGCGCCGAGGTGCCGTCCCTACAGGCCGCCGTCACCCTTCTCACCGACTTTGAAGAG
GCCAATGATATTCACGACTGGCAGATCGGTACCCACGGCATCCGTCTCTCGTTTTCTGATCGCGGTCGTCGCTAC
GGATCCACCTACTTGCCCGACGTCGCCGTCGATCAGGGCTGGTCCAAGGACGAGACCATCTACAACCTTGTCCGC
AAGGCTGGCTGGATGGGGAGTCGCTCCCGCTGGAAAGATCTTGATCTCGAAGTGACGCGCTACCAAGGCAAGAAA
TACGTCATGGACTACTCAGAGTACAAGGGATGGCGCGACTGGATGACGGCCACCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail