Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05235
Gene name
Locationscaffold_05:2849884..2850818
Strand+
Gene length (bp)934
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.2E-19 104 211
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 3.3E-06 54 85
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 1.1E-04 100 143

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.4159 0.3191 0.1266 0.1987 0.7946 0.0683 0.0785 0.0762 0.146 0.1207

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6764
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05235 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7083
Ophiocordyceps kimflemingae Ophio5|3718
Ophiocordyceps subramaniannii Hirsu2|8163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05235
MTAQALVAKPTFRTGPSFVRLRLHSSEATSPTTKMLRFQLNSPNDVSGLGLGGERGFLDLCVKKYPGGKMSTHLH
SLSPGDTLLFPVGIPGYKWKANSHAQIVLIAGGQGITPIFTLARGVLENPDDRTRIHLIYGVRDESEILFRERFN
LWQRSFPDRFQISYVLSNPGPDSSHQGTRIDAGVLASLLAESAGQQSTRVFVSGPPAMEKSLLGGNWWTGGGGGA
LAQLGYESSQVYKF*
Coding >Ophcf2|05235
ATGACCGCCCAAGCCCTAGTCGCAAAGCCCACGTTCCGCACGGGACCAAGCTTCGTCCGTCTACGCCTGCACAGC
AGCGAGGCCACAAGCCCAACGACAAAGATGCTTCGTTTCCAGCTCAACTCTCCCAACGACGTCAGCGGTCTTGGC
CTAGGCGGAGAAAGAGGCTTCCTCGACCTCTGCGTCAAGAAATACCCCGGCGGAAAGATGAGCACTCACCTCCAC
TCCCTCTCCCCGGGCGACACCCTCCTCTTCCCCGTCGGCATCCCGGGCTACAAATGGAAAGCCAACTCGCACGCA
CAAATCGTCCTCATCGCCGGCGGACAGGGCATAACGCCCATCTTCACCCTCGCCCGCGGCGTCCTCGAGAATCCC
GACGACCGGACGAGGATTCACCTCATCTACGGCGTCAGGGACGAGTCGGAAATTCTCTTCCGGGAACGCTTCAAT
CTTTGGCAGCGCTCTTTTCCCGACCGCTTTCAGATCTCGTACGTGCTCAGCAACCCGGGTCCGGATTCCTCCCAT
CAGGGTACCAGGATCGACGCCGGTGTTCTTGCTAGCTTGCTGGCTGAATCGGCTGGCCAGCAGAGTACACGCGTC
TTCGTGAGCGGGCCGCCGGCAATGGAGAAGAGCTTGCTGGGCGGGAACTGGTGGACGGGAGGGGGGGGTGGTGCG
CTGGCTCAGCTTGGATACGAGAGTAGCCAGGTTTATAAGTTTTGA
Transcript >Ophcf2|05235
ATGACCGCCCAAGCCCTAGTCGCAAAGCCCACGTTCCGCACGGGACCAAGCTTCGTCCGTCTACGCCTGCACAGC
AGCGAGGCCACAAGCCCAACGACAAAGATGCTTCGTTTCCAGCTCAACTCTCCCAACGACGTCAGCGGTCTTGGC
CTAGGCGGAGAAAGAGGCTTCCTCGACCTCTGCGTCAAGAAATACCCCGGCGGAAAGATGAGCACTCACCTCCAC
TCCCTCTCCCCGGGCGACACCCTCCTCTTCCCCGTCGGCATCCCGGGCTACAAATGGAAAGCCAACTCGCACGCA
CAAATCGTCCTCATCGCCGGCGGACAGGGCATAACGCCCATCTTCACCCTCGCCCGCGGCGTCCTCGAGAATCCC
GACGACCGGACGAGGATTCACCTCATCTACGGCGTCAGGGACGAGTCGGAAATTCTCTTCCGGGAACGCTTCAAT
CTTTGGCAGCGCTCTTTTCCCGACCGCTTTCAGATCTCGTACGTGCTCAGCAACCCGGGTCCGGATTCCTCCCAT
CAGGGTACCAGGATCGACGCCGGTGTTCTTGCTAGCTTGCTGGCTGAATCGGCTGGCCAGCAGAGTACACGCGTC
TTCGTGAGCGGGCCGCCGGCAATGGAGAAGAGCTTGCTGGGCGGGAACTGGTGGACGGGAGGGGGGGGTGGTGCG
CTGGCTCAGCTTGGATACGAGAGTAGCCAGGTTTATAAGTTTTGA
Gene >Ophcf2|05235
ATGACCGCCCAAGCCCTAGTCGCAAAGCCCACGTTCCGCACGGGACCAAGCTTCGTCCGTCTACGCCTGCACAGC
AGCGAGGCCACAAGCCCAACGACAAAGATGCTTCGTTTCCAGCTCAACTCTCCCAACGACGTCAGCGGTCTTGGC
CTAGGCGGTAAGGGCAGAAAAACCCCCTCCATCATCCCTCTTTCAACTTTCACAAACTAAAGTGTCCGAAACGGT
CCTTCAGCTTCGGTCCTAGCCGCAGCTTGGCCAGAAGGGAGCCTCGCACCCGTAGTCCGTCCCTACACCCTCGTC
AGCCGCGTCGGTACATACAATCTTGCCTGTTTTTTTTGTCTCAACCATACACCAATCTAACAAGCCAGCAGGAGA
AAGAGGCTTCCTCGACCTCTGCGTCAAGAAATACCCCGGCGGAAAGATGAGCACTCACCTCCACTCCCTCTCCCC
GGGCGACACCCTCCTCTTCCCCGTCGGCATCCCGGGCTACAAATGGAAAGCCAACTCGCACGCACAAATCGTCCT
CATCGCCGGCGGACAGGGCATAACGCCCATCTTCACCCTCGCCCGCGGCGTCCTCGAGAATCCCGACGACCGGAC
GAGGATTCACCTCATCTACGGCGTCAGGGACGAGTCGGAAATTCTCTTCCGGGAACGCTTCAATCTTTGGCAGCG
CTCTTTTCCCGACCGCTTTCAGATCTCGTACGTGCTCAGCAACCCGGGTCCGGATTCCTCCCATCAGGGTACCAG
GATCGACGCCGGTGTTCTTGCTAGCTTGCTGGCTGAATCGGCTGGCCAGCAGAGTACACGCGTCTTCGTGAGCGG
GCCGCCGGCAATGGAGAAGAGCTTGCTGGGCGGGAACTGGTGGACGGGAGGGGGGGGTGGTGCGCTGGCTCAGCT
TGGATACGAGAGTAGCCAGGTTTATAAGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail