Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05227
Gene name
Locationscaffold_05:2830861..2831651
Strand-
Gene length (bp)790
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 1.1E-56 23 225

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 66 84 18
3 94 116 22
4 129 151 22
5 156 178 22
6 191 213 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 64.26 33.1 95.43
Alive In ants, during behavior modification 41.75 18.7 64.80
Dead In ants, recently dead 38.84 18.0 59.69

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.053979 no
Alive Dead 0.773499 no
Dead Fungus 0.023838 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05227
MVDSAEVKPHQATVSQVRDPRFFRLGNPGPLGLISFALTTFVLSLYLCGAGLPDGNPLGAVGPDQVILGLAIFLG
GAAQFTAGIMEFRVGNTFGTTVHCSYGAFWLAFAMLRVPQLGIKEAYKGDERAFSFAIGIMLILWSFLTILFVMA
ALRTNLAILVVLILLVLAFFFLALGQFLSTEHLVAARRLTRAGGIFGALCALGAFYAGGAGLMTEETTWVRFPLG
EFAYGRVRGEVV*
Coding >Ophcf2|05227
ATGGTTGACTCGGCTGAAGTCAAGCCGCATCAGGCGACCGTCTCGCAGGTTCGCGATCCGCGATTCTTCCGCTTG
GGGAATCCGGGTCCGTTGGGACTCATTAGCTTTGCGCTCACGACTTTTGTGCTGAGTCTTTATCTCTGTGGCGCT
GGGCTTCCTGATGGGAATCCGCTTGGAGCTGTTGGTCCGGATCAGGTCATTCTTGGCCTTGCCATCTTCCTTGGC
GGCGCGGCGCAATTCACGGCTGGAATCATGGAGTTTCGCGTGGGGAACACGTTCGGGACGACGGTTCACTGCTCG
TACGGCGCCTTCTGGCTTGCCTTTGCCATGCTTCGCGTTCCCCAGCTCGGCATCAAGGAAGCATACAAAGGCGAC
GAGCGAGCCTTTAGCTTCGCAATCGGAATCATGCTCATCCTCTGGTCCTTCCTAACCATCCTCTTCGTCATGGCC
GCCCTACGCACCAACCTCGCCATCCTTGTCGTTCTCATCCTCCTCGTCTTGGCCTTCTTCTTCCTCGCCCTGGGT
CAGTTCCTTTCCACGGAGCATCTTGTTGCTGCGAGGCGGCTTACGCGTGCGGGGGGGATCTTTGGTGCGCTTTGT
GCGCTGGGGGCTTTTTATGCGGGGGGCGCGGGGCTGATGACGGAGGAGACGACTTGGGTGCGTTTTCCGCTGGGG
GAGTTTGCGTATGGGAGGGTTAGGGGTGAGGTTGTGTGA
Transcript >Ophcf2|05227
ATGGTTGACTCGGCTGAAGTCAAGCCGCATCAGGCGACCGTCTCGCAGGTTCGCGATCCGCGATTCTTCCGCTTG
GGGAATCCGGGTCCGTTGGGACTCATTAGCTTTGCGCTCACGACTTTTGTGCTGAGTCTTTATCTCTGTGGCGCT
GGGCTTCCTGATGGGAATCCGCTTGGAGCTGTTGGTCCGGATCAGGTCATTCTTGGCCTTGCCATCTTCCTTGGC
GGCGCGGCGCAATTCACGGCTGGAATCATGGAGTTTCGCGTGGGGAACACGTTCGGGACGACGGTTCACTGCTCG
TACGGCGCCTTCTGGCTTGCCTTTGCCATGCTTCGCGTTCCCCAGCTCGGCATCAAGGAAGCATACAAAGGCGAC
GAGCGAGCCTTTAGCTTCGCAATCGGAATCATGCTCATCCTCTGGTCCTTCCTAACCATCCTCTTCGTCATGGCC
GCCCTACGCACCAACCTCGCCATCCTTGTCGTTCTCATCCTCCTCGTCTTGGCCTTCTTCTTCCTCGCCCTGGGT
CAGTTCCTTTCCACGGAGCATCTTGTTGCTGCGAGGCGGCTTACGCGTGCGGGGGGGATCTTTGGTGCGCTTTGT
GCGCTGGGGGCTTTTTATGCGGGGGGCGCGGGGCTGATGACGGAGGAGACGACTTGGGTGCGTTTTCCGCTGGGG
GAGTTTGCGTATGGGAGGGTTAGGGGTGAGGTTGTGTGA
Gene >Ophcf2|05227
ATGGTTGACTCGGCTGAAGTCAAGCCGCATCAGGCGACCGTCTCGCAGGTTCGCGATCCGCGATTCTTCCGCTTG
GGGAATCCGGGTCCGTTGGGACTCATTAGCTTTGCGCTCACGACTTTTGTGCTGAGTCTTTATCTCTGTGGCGCT
GGGTATGATTTCCTTCTTCCCTCTTCCCCCTTCCATCTTCCCACTCACCTCTTTTCCATTCTCTTTTGACGAGTG
TAGGCTTCCTGATGGGAATCCGCTTGGAGCTGTTGGTCCGGATCAGGTCATTCTTGGCCTTGCCATCTTCCTTGG
CGGCGCGGCGCAATTCACGGCTGGAATCATGGAGTTTCGCGTGGGGAACACGTTCGGGACGACGGTTCACTGCTC
GTACGGCGCCTTCTGGCTTGCCTTTGCCATGCTTCGCGTTCCCCAGCTCGGCATCAAGGAAGCATACAAAGGCGA
CGAGCGAGCCTTTAGCTTCGCAATCGGAATCATGCTCATCCTCTGGTCCTTCCTAACCATCCTCTTCGTCATGGC
CGCCCTACGCACCAACCTCGCCATCCTTGTCGTTCTCATCCTCCTCGTCTTGGCCTTCTTCTTCCTCGCCCTGGG
TCAGTTCCTTTCCACGGAGCATCTTGTTGCTGCGAGGCGGCTTACGCGTGCGGGGGGGATCTTTGGTGCGCTTTG
TGCGCTGGGGGCTTTTTATGCGGGGGGCGCGGGGCTGATGACGGAGGAGACGACTTGGGTGCGTTTTCCGCTGGG
GGAGTTTGCGTATGGGAGGGTTAGGGGTGAGGTTGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail