Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05225
Gene name
Locationscaffold_05:2825077..2826898
Strand+
Gene length (bp)1821
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02934 GatB_N GatB/GatE catalytic domain 3.5E-98 86 375
PF02637 GatB_Yqey GatB domain 3.4E-06 446 599

GO

GO Term Description Terminal node
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor Yes
GO:0016874 ligase activity Yes
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1506 0.1321 0.0782 0.0401 0.9117 0.0744 0.037 0.0678 0.1173 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3398
Ophiocordyceps australis map64 (Brazil) OphauB2|6621
Ophiocordyceps camponoti-floridani Ophcf2|05225 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5370
Ophiocordyceps kimflemingae Ophio5|7652
Ophiocordyceps subramaniannii Hirsu2|1662

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05225
MRRLPVSELRAYLLRGTVSPPRGCLTVTSPHLAGTVSRALHTAPQPSQPPDVPLRKQLREEARRAKKEGSKKRKT
DSQVVDGWELTVGIEIHAQLNTARKLFSDAFTSFNDEPNSHVALFDVAMPGSQPLFNKEVLLPALRASLALNCHV
QRVSCFDRKHYFWWDQPAGYQITQYYKPLARNGHITLYARDGIAPEDGESVTVGIRQIQLEQDTAKTLAQADKVH
WLDFNRVGVPLIEIITEPDLHHPRTAAILVRKVQLMLSSVDACVSGMEAGGLRADVNVSVRRVHEPTSKPGVRTE
IKNLSTIKAVEDAIIAERDRQIRELEAGSVIAGETRGWTIGAKETRRLRGKEGEVDYRYMPDPDIAPLIVADDLV
DHVQNSLAILPDAELDLLVGKWGLTAKDAMSLLSLNTGSRVQYFYRVVSSLGEKLAAEFAPRPAPELSQYSPLVG
NWILHELGRTTALESGSLADKELNFTPEGDCARVPISALSQLLFHLYCKHITGKVAKELLLAIYLGELDDGVQAA
IEANDLWFKELSADEYAALADSAMEGEEKVLREFGWKEEFPQGKLMFLVGKMIRLGPAERIDPMAAREALKARIR
LRRGGA*
Coding >Ophcf2|05225
ATGCGCCGCCTGCCCGTCTCAGAGCTCAGGGCCTATCTCTTGCGAGGCACTGTCTCGCCACCACGCGGCTGCCTC
ACCGTGACGAGTCCTCACCTGGCTGGCACAGTCAGCAGAGCTCTTCACACCGCTCCCCAGCCTTCGCAGCCTCCA
GACGTCCCCCTCCGCAAGCAATTGAGAGAAGAAGCCAGACGAGCCAAGAAGGAGGGAAGCAAGAAGCGCAAGACC
GACTCTCAGGTCGTCGACGGTTGGGAATTGACGGTCGGTATCGAGATTCACGCCCAGCTCAACACAGCCCGCAAG
CTCTTCTCCGACGCCTTTACCTCGTTTAACGATGAGCCCAACAGCCATGTCGCTCTCTTTGACGTCGCCATGCCG
GGAAGCCAGCCGCTTTTCAACAAAGAGGTGCTGCTTCCGGCTCTCAGGGCATCGCTGGCCTTGAACTGCCATGTG
CAGCGAGTCAGCTGCTTCGATCGGAAGCACTACTTCTGGTGGGATCAGCCCGCAGGCTACCAGATCACGCAATAC
TATAAGCCGCTCGCACGGAACGGTCACATAACGTTGTATGCGCGGGACGGTATCGCGCCGGAGGACGGCGAGAGC
GTCACCGTCGGCATCAGACAGATCCAGCTGGAGCAGGACACGGCCAAGACGCTCGCCCAGGCAGACAAGGTGCAC
TGGCTCGACTTTAACCGAGTCGGTGTGCCCTTGATCGAGATCATCACGGAGCCGGACCTCCACCACCCGCGGACG
GCGGCCATCCTTGTTCGCAAAGTGCAGCTCATGCTCAGCTCCGTCGACGCCTGCGTCTCGGGCATGGAAGCGGGC
GGTCTCCGCGCCGACGTCAATGTGTCCGTCAGGCGGGTCCATGAACCGACGTCGAAGCCCGGCGTGCGGACCGAG
ATCAAGAACCTGAGCACCATCAAGGCCGTGGAGGATGCCATCATTGCCGAACGAGACCGGCAGATTCGAGAGCTG
GAAGCCGGCAGCGTCATCGCCGGCGAGACCCGCGGCTGGACGATTGGTGCCAAGGAGACGCGCCGGCTTCGGGGA
AAAGAGGGCGAGGTCGATTACCGCTACATGCCTGACCCGGACATTGCGCCGCTCATCGTCGCCGACGACTTGGTC
GACCACGTGCAGAACTCGCTCGCCATACTACCCGATGCCGAGCTCGATCTTCTCGTCGGCAAATGGGGTCTCACG
GCCAAGGACGCCATGTCGCTGCTATCGCTGAACACGGGATCCCGCGTGCAGTACTTTTACCGGGTGGTGAGCAGC
CTCGGGGAGAAGCTCGCGGCCGAGTTTGCGCCCAGACCGGCGCCGGAGCTCTCCCAGTATTCGCCCCTGGTCGGC
AACTGGATCCTACACGAGCTCGGGCGGACGACGGCCCTTGAGAGCGGATCGCTAGCGGATAAGGAGCTCAACTTC
ACGCCCGAGGGCGACTGCGCGCGAGTGCCCATCTCGGCGCTCTCGCAGCTACTCTTCCACCTCTACTGTAAGCAC
ATCACGGGCAAGGTAGCCAAGGAGCTTCTGCTAGCCATCTACCTGGGCGAGCTCGACGACGGGGTGCAGGCAGCC
ATCGAAGCCAACGACCTGTGGTTCAAGGAACTCTCGGCGGACGAGTACGCGGCGCTGGCAGACTCGGCCATGGAA
GGAGAGGAAAAGGTGCTTCGGGAATTCGGCTGGAAGGAGGAATTTCCGCAGGGAAAGCTCATGTTTCTCGTCGGT
AAGATGATACGGCTAGGGCCAGCGGAGCGGATCGACCCGATGGCTGCGAGGGAGGCTCTCAAGGCTCGGATCCGG
CTGCGTCGGGGGGGTGCCTAG
Transcript >Ophcf2|05225
ATGCGCCGCCTGCCCGTCTCAGAGCTCAGGGCCTATCTCTTGCGAGGCACTGTCTCGCCACCACGCGGCTGCCTC
ACCGTGACGAGTCCTCACCTGGCTGGCACAGTCAGCAGAGCTCTTCACACCGCTCCCCAGCCTTCGCAGCCTCCA
GACGTCCCCCTCCGCAAGCAATTGAGAGAAGAAGCCAGACGAGCCAAGAAGGAGGGAAGCAAGAAGCGCAAGACC
GACTCTCAGGTCGTCGACGGTTGGGAATTGACGGTCGGTATCGAGATTCACGCCCAGCTCAACACAGCCCGCAAG
CTCTTCTCCGACGCCTTTACCTCGTTTAACGATGAGCCCAACAGCCATGTCGCTCTCTTTGACGTCGCCATGCCG
GGAAGCCAGCCGCTTTTCAACAAAGAGGTGCTGCTTCCGGCTCTCAGGGCATCGCTGGCCTTGAACTGCCATGTG
CAGCGAGTCAGCTGCTTCGATCGGAAGCACTACTTCTGGTGGGATCAGCCCGCAGGCTACCAGATCACGCAATAC
TATAAGCCGCTCGCACGGAACGGTCACATAACGTTGTATGCGCGGGACGGTATCGCGCCGGAGGACGGCGAGAGC
GTCACCGTCGGCATCAGACAGATCCAGCTGGAGCAGGACACGGCCAAGACGCTCGCCCAGGCAGACAAGGTGCAC
TGGCTCGACTTTAACCGAGTCGGTGTGCCCTTGATCGAGATCATCACGGAGCCGGACCTCCACCACCCGCGGACG
GCGGCCATCCTTGTTCGCAAAGTGCAGCTCATGCTCAGCTCCGTCGACGCCTGCGTCTCGGGCATGGAAGCGGGC
GGTCTCCGCGCCGACGTCAATGTGTCCGTCAGGCGGGTCCATGAACCGACGTCGAAGCCCGGCGTGCGGACCGAG
ATCAAGAACCTGAGCACCATCAAGGCCGTGGAGGATGCCATCATTGCCGAACGAGACCGGCAGATTCGAGAGCTG
GAAGCCGGCAGCGTCATCGCCGGCGAGACCCGCGGCTGGACGATTGGTGCCAAGGAGACGCGCCGGCTTCGGGGA
AAAGAGGGCGAGGTCGATTACCGCTACATGCCTGACCCGGACATTGCGCCGCTCATCGTCGCCGACGACTTGGTC
GACCACGTGCAGAACTCGCTCGCCATACTACCCGATGCCGAGCTCGATCTTCTCGTCGGCAAATGGGGTCTCACG
GCCAAGGACGCCATGTCGCTGCTATCGCTGAACACGGGATCCCGCGTGCAGTACTTTTACCGGGTGGTGAGCAGC
CTCGGGGAGAAGCTCGCGGCCGAGTTTGCGCCCAGACCGGCGCCGGAGCTCTCCCAGTATTCGCCCCTGGTCGGC
AACTGGATCCTACACGAGCTCGGGCGGACGACGGCCCTTGAGAGCGGATCGCTAGCGGATAAGGAGCTCAACTTC
ACGCCCGAGGGCGACTGCGCGCGAGTGCCCATCTCGGCGCTCTCGCAGCTACTCTTCCACCTCTACTGTAAGCAC
ATCACGGGCAAGGTAGCCAAGGAGCTTCTGCTAGCCATCTACCTGGGCGAGCTCGACGACGGGGTGCAGGCAGCC
ATCGAAGCCAACGACCTGTGGTTCAAGGAACTCTCGGCGGACGAGTACGCGGCGCTGGCAGACTCGGCCATGGAA
GGAGAGGAAAAGGTGCTTCGGGAATTCGGCTGGAAGGAGGAATTTCCGCAGGGAAAGCTCATGTTTCTCGTCGGT
AAGATGATACGGCTAGGGCCAGCGGAGCGGATCGACCCGATGGCTGCGAGGGAGGCTCTCAAGGCTCGGATCCGG
CTGCGTCGGGGGGGTGCCTAG
Gene >Ophcf2|05225
ATGCGCCGCCTGCCCGTCTCAGAGCTCAGGGCCTATCTCTTGCGAGGCACTGTCTCGCCACCACGCGGCTGCCTC
ACCGTGACGAGTCCTCACCTGGCTGGCACAGTCAGCAGAGCTCTTCACACCGCTCCCCAGCCTTCGCAGCCTCCA
GACGTCCCCCTCCGCAAGCAATTGAGAGAAGAAGCCAGACGAGCCAAGAAGGAGGGAAGCAAGAAGCGCAAGACC
GACTCTCAGGTCGTCGACGGTTGGGAATTGACGGTCGGTATCGAGATTCACGCCCAGCTCAACACAGCCCGCAAG
CTCTTCTCCGACGCCTTTACCTCGTTTAACGATGAGCCCAACAGCCATGTCGCTCTCTTTGACGTCGCCATGCCG
GGAAGCCAGCCGCTTTTCAACAAAGAGGTGCTGCTTCCGGCTCTCAGGGCATCGCTGGCCTTGAACTGCCATGTG
CAGCGAGTCAGCTGCTTCGATCGGAAGCACTACTTCTGGTGGGATCAGCCCGCAGGCTACCAGATCACGCAATAC
TATAAGCCGCTCGCACGGAACGGTCACATAACGTTGTATGCGCGGGACGGTATCGCGCCGGAGGACGGCGAGAGC
GTCACCGTCGGCATCAGACAGATCCAGCTGGAGCAGGACACGGCCAAGACGCTCGCCCAGGCAGACAAGGTGCAC
TGGCTCGACTTTAACCGAGTCGGTGTGCCCTTGATCGAGATCATCACGGAGCCGGACCTCCACCACCCGCGGACG
GCGGCCATCCTTGTTCGCAAAGTGCAGCTCATGCTCAGCTCCGTCGACGCCTGCGTCTCGGGCATGGAAGCGGGC
GGTCTCCGCGCCGACGTCAATGTGTCCGTCAGGCGGGTCCATGAACCGACGTCGAAGCCCGGCGTGCGGACCGAG
ATCAAGAACCTGAGCACCATCAAGGCCGTGGAGGATGCCATCATTGCCGAACGAGACCGGCAGATTCGAGAGCTG
GAAGCCGGCAGCGTCATCGCCGGCGAGACCCGCGGCTGGACGATTGGTGCCAAGGAGACGCGCCGGCTTCGGGGA
AAAGAGGGCGAGGTCGATTACCGCTACATGCCTGACCCGGACATTGCGCCGCTCATCGTCGCCGACGACTTGGTC
GACCACGTGCAGAACTCGCTCGCCATACTACCCGATGCCGAGCTCGATCTTCTCGTCGGCAAATGGGGTCTCACG
GCCAAGGACGCCATGTCGCTGCTATCGCTGAACACGGGATCCCGCGTGCAGTACTTTTACCGGGTGGTGAGCAGC
CTCGGGGAGAAGCTCGCGGCCGAGTTTGCGCCCAGACCGGCGCCGGAGCTCTCCCAGTATTCGCCCCTGGTCGGC
AACTGGATCCTACACGAGCTCGGGCGGACGACGGCCCTTGAGAGCGGATCGCTAGCGGATAAGGAGCTCAACTTC
ACGCCCGAGGGCGACTGCGCGCGAGTGCCCATCTCGGCGCTCTCGCAGCTACTCTTCCACCTCTACTGTAAGCAC
ATCACGGGCAAGGTAGCCAAGGAGCTTCTGCTAGCCATCTACCTGGGCGAGCTCGACGACGGGGTGCAGGCAGCC
ATCGAAGCCAACGACCTGTGGTTCAAGGAACTCTCGGCGGACGAGTACGCGGCGCTGGCAGACTCGGCCATGGAA
GGAGAGGAAAAGGTGCTTCGGGAATTCGGCTGGAAGGAGGAATTTCCGCAGGGAAAGCTCATGTTTCTCGTCGGT
AAGATGATACGGCTAGGGCCAGCGGAGCGGATCGACCCGATGGCTGCGAGGGAGGCTCTCAAGGCTCGGATCCGG
CTGCGTCGGGGGGGTGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail