Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05224
Gene name
Locationscaffold_05:2822408..2824502
Strand-
Gene length (bp)2094
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20237 DUF6594 Family of unknown function (DUF6594) 2.9E-28 337 481

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 478 500 22
2 507 524 17
3 530 552 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05224
MERGFEATTAIVRQAPRPNLYRLTHDIAVAIGRIPKLLFSYQRLATPSTRPHPSTWQLTWTFRLSLNCASSRLPS
TTSLRMPTRIVEQAAEPDDLSDDLAIDLPDDLPEARRERAEVMATLMPLPDDGQARTEGGQLQNEHGPDETLAAD
THTPSTLPPSAVLKTLTRSETVKPSPLETTQKPQSAEDDNPLAAIQREASSLYNNHPDAYWAPRPRRRPSALDYL
VESPAGTHSSAGANFGSYQISAPSNISAPPALNGHSHGDAIQERTDAMRRVGYYSLPAEGPPMSDYQRSPAFQHV
VRNPPMAPSRVDAALSQVGPSMLQPGYVAEKPPMSGYQLLAAKLVGGLGGRPVTPMYRRFEALNHRLLLYMQADL
VELEKELQLLDSRDTMERGYGMLPASRRQERWSNSPLAQQRTEVLGQIGYKLSQYNRVMASARKTHKMAIPSLHE
IVEYKTYLAANRLLADEETSFLDAPDDLLALAVFVAVLVPVFTFAIIPGFAGRITVVALVGASIGLSLVQSGLAD
LLDRGALDWVLCAGAYGAVMAVVAGAVA*
Coding >Ophcf2|05224
ATGGAACGTGGCTTCGAGGCGACGACTGCAATAGTCAGACAAGCACCGAGGCCCAACCTGTACAGGCTGACTCAT
GATATAGCCGTGGCCATCGGGAGGATACCAAAGCTGCTGTTTAGCTACCAAAGACTTGCTACTCCATCCACTCGT
CCTCATCCCTCGACCTGGCAGCTCACATGGACCTTTCGTCTGAGCCTGAACTGTGCTTCGAGCCGGCTGCCGTCG
ACGACATCGTTGAGGATGCCGACCAGGATTGTTGAGCAGGCAGCTGAACCAGACGACTTATCCGACGACTTAGCC
ATCGACTTACCCGACGACTTACCCGAAGCTCGTAGAGAGAGGGCCGAAGTGATGGCCACTTTGATGCCTCTGCCC
GACGACGGCCAAGCAAGGACTGAGGGCGGCCAGCTGCAGAATGAACACGGCCCAGATGAAACCCTGGCCGCGGAC
ACTCACACGCCATCAACGCTCCCCCCTTCGGCCGTCCTCAAGACGCTGACCAGGTCGGAGACCGTCAAGCCGTCG
CCCCTCGAGACGACACAGAAGCCGCAGTCGGCTGAAGATGACAATCCTCTCGCGGCGATTCAGAGGGAAGCGTCA
TCGTTGTACAACAACCACCCGGACGCTTACTGGGCTCCGCGTCCCCGACGGCGTCCCAGCGCCTTGGACTACCTC
GTCGAGTCCCCGGCAGGAACACACTCTTCTGCAGGGGCTAACTTTGGTTCCTATCAAATCTCGGCCCCTTCCAAC
ATCTCTGCGCCACCGGCGCTTAACGGCCATTCTCACGGCGATGCTATCCAAGAACGAACTGATGCCATGAGACGC
GTGGGATACTACTCGCTCCCCGCCGAAGGGCCGCCCATGTCGGACTATCAGCGCTCGCCGGCCTTTCAACACGTC
GTTAGAAACCCCCCCATGGCTCCCTCACGCGTCGACGCAGCCCTATCGCAAGTCGGTCCGAGCATGCTGCAGCCC
GGCTACGTAGCGGAAAAGCCACCGATGAGCGGCTACCAGCTTCTGGCCGCCAAGCTCGTCGGTGGCCTCGGCGGA
CGCCCGGTGACGCCCATGTACCGCCGCTTCGAGGCCCTCAACCACCGGCTACTGCTGTACATGCAAGCCGACCTC
GTGGAGCTGGAGAAGGAGCTCCAGTTACTCGACTCTAGAGACACGATGGAGAGGGGCTACGGCATGCTTCCCGCC
TCGCGTCGACAGGAGCGCTGGTCGAACAGTCCACTGGCGCAGCAGAGAACGGAGGTTCTGGGGCAGATTGGTTAT
AAGCTGAGCCAGTACAACAGAGTCATGGCTTCGGCTCGCAAGACGCACAAGATGGCGATACCTTCACTGCACGAG
ATTGTCGAGTACAAGACGTACTTGGCGGCCAATCGCCTCCTAGCAGACGAAGAGACGAGCTTCCTCGACGCCCCA
GACGATCTCCTAGCCCTCGCCGTCTTCGTCGCCGTCCTAGTCCCCGTCTTCACCTTTGCCATCATCCCCGGGTTC
GCGGGCCGCATCACCGTCGTGGCGCTCGTGGGCGCCAGCATCGGCCTTTCGCTCGTGCAGTCGGGGCTGGCGGAT
TTGCTGGATAGGGGGGCTCTGGACTGGGTCCTTTGCGCGGGAGCGTATGGGGCTGTTATGGCGGTTGTTGCTGGG
GCGGTGGCTTAG
Transcript >Ophcf2|05224
ATGGAACGTGGCTTCGAGGCGACGACTGCAATAGTCAGACAAGCACCGAGGCCCAACCTGTACAGGCTGACTCAT
GATATAGCCGTGGCCATCGGGAGGATACCAAAGCTGCTGTTTAGCTACCAAAGACTTGCTACTCCATCCACTCGT
CCTCATCCCTCGACCTGGCAGCTCACATGGACCTTTCGTCTGAGCCTGAACTGTGCTTCGAGCCGGCTGCCGTCG
ACGACATCGTTGAGGATGCCGACCAGGATTGTTGAGCAGGCAGCTGAACCAGACGACTTATCCGACGACTTAGCC
ATCGACTTACCCGACGACTTACCCGAAGCTCGTAGAGAGAGGGCCGAAGTGATGGCCACTTTGATGCCTCTGCCC
GACGACGGCCAAGCAAGGACTGAGGGCGGCCAGCTGCAGAATGAACACGGCCCAGATGAAACCCTGGCCGCGGAC
ACTCACACGCCATCAACGCTCCCCCCTTCGGCCGTCCTCAAGACGCTGACCAGGTCGGAGACCGTCAAGCCGTCG
CCCCTCGAGACGACACAGAAGCCGCAGTCGGCTGAAGATGACAATCCTCTCGCGGCGATTCAGAGGGAAGCGTCA
TCGTTGTACAACAACCACCCGGACGCTTACTGGGCTCCGCGTCCCCGACGGCGTCCCAGCGCCTTGGACTACCTC
GTCGAGTCCCCGGCAGGAACACACTCTTCTGCAGGGGCTAACTTTGGTTCCTATCAAATCTCGGCCCCTTCCAAC
ATCTCTGCGCCACCGGCGCTTAACGGCCATTCTCACGGCGATGCTATCCAAGAACGAACTGATGCCATGAGACGC
GTGGGATACTACTCGCTCCCCGCCGAAGGGCCGCCCATGTCGGACTATCAGCGCTCGCCGGCCTTTCAACACGTC
GTTAGAAACCCCCCCATGGCTCCCTCACGCGTCGACGCAGCCCTATCGCAAGTCGGTCCGAGCATGCTGCAGCCC
GGCTACGTAGCGGAAAAGCCACCGATGAGCGGCTACCAGCTTCTGGCCGCCAAGCTCGTCGGTGGCCTCGGCGGA
CGCCCGGTGACGCCCATGTACCGCCGCTTCGAGGCCCTCAACCACCGGCTACTGCTGTACATGCAAGCCGACCTC
GTGGAGCTGGAGAAGGAGCTCCAGTTACTCGACTCTAGAGACACGATGGAGAGGGGCTACGGCATGCTTCCCGCC
TCGCGTCGACAGGAGCGCTGGTCGAACAGTCCACTGGCGCAGCAGAGAACGGAGGTTCTGGGGCAGATTGGTTAT
AAGCTGAGCCAGTACAACAGAGTCATGGCTTCGGCTCGCAAGACGCACAAGATGGCGATACCTTCACTGCACGAG
ATTGTCGAGTACAAGACGTACTTGGCGGCCAATCGCCTCCTAGCAGACGAAGAGACGAGCTTCCTCGACGCCCCA
GACGATCTCCTAGCCCTCGCCGTCTTCGTCGCCGTCCTAGTCCCCGTCTTCACCTTTGCCATCATCCCCGGGTTC
GCGGGCCGCATCACCGTCGTGGCGCTCGTGGGCGCCAGCATCGGCCTTTCGCTCGTGCAGTCGGGGCTGGCGGAT
TTGCTGGATAGGGGGGCTCTGGACTGGGTCCTTTGCGCGGGAGCGTATGGGGCTGTTATGGCGGTTGTTGCTGGG
GCGGTGGCTTAG
Gene >Ophcf2|05224
ATGGAACGTGGCTTCGAGGCGACGACTGCAATAGTCAGACAAGCACCGAGGCCCAACCTGTACAGGCTGACTCAT
GATATAGCCGTGGCCATCGGGAGGGTGCGTCGACGCCTTGCACTGCATCTTGCCCGTTGTTTGATTCCCTTTTTC
TGTCTTCCTTGCCTGTGAAATGCTGAGCTGATTTCAGATACCAAAGCTGCTGTTTAGCTACCAAAGACTTGCTAC
TCCATCCACTCGTCCTCATCCCTCGACCTGGCAGCTCACATGGACCTTTCGTCTGAGCCTGAACTGTGCTTCGAG
CCGGCTGCCGTCGACGACATCGTTGAGGATGCCGACCAGGAGTCTCCCTCTTTGATGCCCTCGGTACTTGGTGAC
ATTGACGACGCATGTTGGCGAGAATCGCAATTTATGACTCCAGTTGTTGAGCAGGCAGCTGAACCAGACGACTTA
TCCGACGACTTAGCCATCGACTTACCCGACGACTTACCCGAAGCTCGTAGAGAGAGGGCCGAAGTGATGGCCACT
TTGATGCCTCTGCCCGACGACGGCCAAGCAAGGACTGAGGGCGGCCAGCTGCAGAATGAACACGGCCCAGATGAA
ACCCTGGCCGCGGACACTCACACGCCATCAACGCTCCCCCCTTCGGCCGTCCTCAAGACGCTGACCAGGTCGGAG
ACCGTCAAGCCGTCGCCCCTCGAGACGACACAGAAGCCGCAGTCGGCTGAAGATGACAATCCTCTCGCGGCGATT
CAGAGGGAAGCGTCATCGTTGTACAACAACCACCCGGACGCTTACTGGGCTCCGCGTCCCCGACGGCGTCCCAGC
GCCTTGGACTACCTCGTCGAGTCCCCGGCAGGAACACACTCTTCTGCAGGGGCTAACTTTGGTTCCTATCAAATC
TCGGCCCCTTCCAACATCTCTGCGCCACCGGCGCTTAACGGCCATTCTCACGGCGATGCTATCCAAGAACGAACT
GATGCCATGAGACGCGTGGGATACTACTCGCTCCCCGCCGAAGGGCCGCCCATGTCGGACTATCAGCGCTCGCCG
GCCTTTCAACACGTCGTTAGAAACCCCCCCATGGCTCCCTCACGCGTCGACGCAGCCCTATCGCAAGTCGGTCCG
AGCATGCTGCAGCCCGGCTACGTAGCGGAAAAGCCACCGATGAGCGGCTACCAGCTTCTGGCCGCCAAGCTCGTC
GGTGGCCTCGGCGGACGCCCGGTGACGCCCATGTACCGCCGCTTCGAGGCCCTCAACCACCGGCTACTGCTGTAC
ATGCAAGCCGACCTCGTGGAGCTGGAGAAGGAGCTCCAGTTACTCGACTCTAGAGACACGATGGAGAGGGGCTAC
GGCATGCTTCCCGCCTCGCGTCGACAGGAGCGCTGGTCGAACAGTCCACTGGCGCAGCAGAGAACGGAGGTTCTG
GGGCAGATTGGTTATAAGCTGAGCCAGTACAGTAAGTTTATGGCGTTTATGATGATGTTTCATCTCGTCTCCTGA
CTCCTCGTCAGACAGAGTCATGGCTTCGGCTCGCAAGACGCACAAGATGGCGATACCTTCACTGCACGAGATTGT
CGAGTACAAGACGTACTTGGCGGCCAATCGCCTCCTAGCAGACGAAGAGACGAGCTTCCTCGACGCCCCAGACGA
TCTCGTCTGTCCTTTCAAGGAAACCCCAACAACAGCCCTCGTCAAGACGGAAGAAACAGCAAAATGCCAACAAGA
ACACCCCCCAGTCCCAATGCCCGCAATGGCCGCCGCCCCCCCATCACCAACCCAAGACCCGCCCCTACGTCCGAA
TCCGCCAGCGTCGTGACCTCGAGGCGAGAAGAAGAGAACGGCGTGCTAGAAGCCTCGCTATCCCAGCTAGCCCTC
GCCGTCTTCGTCGCCGTCCTAGTCCCCGTCTTCACCTTTGCCATCATCCCCGGGTTCGCGGGCCGCATCACCGTC
GTGGCGCTCGTGGGCGCCAGCATCGGCCTTTCGCTCGTGCAGTCGGGGCTGGCGGATTTGCTGGATAGGGGGGCT
CTGGACTGGGTCCTTTGCGCGGGAGCGTATGGGGCTGTTATGGCGGTTGTTGCTGGGGCGGTGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail