Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05222
Gene name
Locationscaffold_05:2815929..2819954
Strand+
Gene length (bp)4025
Transcript length (bp)3816
Coding sequence length (bp)3816
Protein length (aa) 1272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00637 Clathrin Region in Clathrin and VPS 2.1E-19 940 1088

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0015031 protein transport No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.359 0.5173 0.0894 0.0239 0.0382 0.004 0.2472 0.6045 0.4466 0.0143

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4596
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2561
Ophiocordyceps australis map64 (Brazil) OphauB2|6615
Ophiocordyceps camponoti-floridani Ophcf2|05222 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4247
Ophiocordyceps kimflemingae Ophio5|6632
Ophiocordyceps subramaniannii Hirsu2|9648

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05222
MTGPPPIESRAHGGPAHGDGIQPADTASRGRSQQRQPAAEGHDSGYTGNKAVEGISSSGEDDEDDSEDADEDEDE
DEDEDEEPQLKYARMTQHLAAVYRNGDATSAFLVAGDKMIIGTHNGNIHVLQLPTFQSLRVYHAHSASVTSISIS
PYPPPLPGDKTIVSLRPPVSHSKSGTRHSETPPSAAASRRTREPLPLPKLPSNEIYIATSSMDGNVCIQSLTDIK
DVQLRNFARPIQTVALSPEYKLDRTYLSGGLAGQLILTVGGGQGRSTSTTTGTAAAAASGWLGSMGLGHNTGKDS
VLHSGEGSISCIKWSLSGKYVVWLNEYGIKIMRSKLHLESSDSDHAWKRMAHIDRPQTDDWETMASVWKGRAEWI
DDKAIGNDEAEPRASTDSPSAVAPKLREQANSKAIERLLVGWGGTIWIIHVHPGAGTGKGSGQMALGRAEVAKIF
RMDCIISGISLYTQSLLLVLAFCSDGDDAKVKQKRNSSRGSKRRARSGSLQSLTDHQPPELRLIDLSSQTEVDKI
ILSINRYERLSSADYHLSVLPARTAASAAASKGTLEALAGLGTDVWNAAINPKSLFSSGASIKSRDSGDDGGSAS
KTASIAGTIRTSRPTVSAAHPSLVKPGAKIFIHSPYDCILATKRDLADHLSWLLENEQFQRAWELLDENPDIVSP
PIDKTGDVASTPSKTHSAADDFYDDESAMDATNRAAVSFAEKEKRRVGELWIQELIEDGDWKAAGQVCGKVVTTP
DRWEKWVYTFAGANRFDEIANHMPSQPLLPPLPSTVYEVILGHYLQNNKPRFQELLATWSTDLFNVAIVSTALEN
QLKFRDVREDSIDDGVKGRDWRIVMQSLSGLYEAGGRNREALKCYIKLHDADSAFRMIRDGHLAEAVADDIPSFL
GLRVDPEKRDSMTKEDLAEATSEAITLLVDEAQHGLVRPETVVKQLEEQQLDLYLYFYLKGLWRGEGIQERTGEN
MDRLVMDSQSLVDDFADLAVHLFSVNDRPMLMEFLKSSTSYTFEKAVQECEDFNYHDELVYLYSKTGQVKRALFL
IIDGLKNVEKAIEFVKEQDDLDLWEDLLTYSMDKPAFIRALLEQVGTVINPVRLVRRIPEGLAIQGLKEGLIHMM
KEHELQHSISSGAVRVLRSELAAAQNELRAGQRRGIKFEVAPRPASVAEGDKHGVGERQAGRCAKCEGPLTELEM
ESLVGFACGHVFHVGHLLEMLDERLDTGLIDVGGEGMETRRHSVGMKVMRARLLRDKIKGGCPMCQQVSKH*
Coding >Ophcf2|05222
ATGACCGGACCGCCGCCAATCGAGAGCCGAGCTCACGGGGGGCCTGCCCACGGCGATGGGATCCAGCCAGCTGAC
ACTGCGAGCCGCGGCCGATCCCAGCAGAGGCAGCCGGCTGCGGAAGGACACGATAGCGGTTATACTGGCAATAAG
GCTGTCGAGGGGATCTCTTCGAGCGGCGAAGACGATGAAGACGACAGTGAAGATGCGGATGAGGACGAGGACGAG
GACGAGGATGAGGACGAGGAGCCGCAGCTCAAATACGCCCGCATGACGCAGCATTTGGCTGCCGTTTATCGCAAT
GGCGACGCAACCAGTGCTTTCCTCGTTGCTGGTGATAAGATGATCATAGGCACTCATAATGGCAACATCCACGTC
CTCCAGCTTCCGACTTTCCAGTCGCTACGGGTCTATCACGCTCATTCGGCGTCGGTAACGAGCATATCCATCTCT
CCGTACCCGCCTCCACTGCCTGGTGACAAGACGATTGTCTCTCTCCGCCCTCCCGTCTCGCATTCAAAGTCTGGT
ACCAGGCATTCGGAGACGCCTCCGTCAGCTGCGGCTTCGAGGAGGACCAGGGAGCCTCTGCCGCTGCCGAAGCTC
CCCTCCAACGAGATCTACATAGCAACTTCATCCATGGACGGCAATGTATGCATACAGTCTCTCACGGATATCAAA
GACGTTCAGCTCCGCAATTTCGCCCGTCCAATACAGACTGTCGCTCTCTCACCGGAGTACAAGCTCGACCGGACT
TATCTCTCAGGCGGCCTGGCAGGCCAACTTATCTTGACGGTAGGCGGCGGTCAGGGGCGAAGCACTTCCACCACG
ACGGGGACCGCTGCGGCCGCAGCTTCTGGCTGGCTTGGCAGCATGGGACTGGGTCACAACACTGGCAAAGACAGC
GTTCTTCACTCCGGAGAGGGTTCCATCAGCTGCATCAAGTGGTCTCTGTCCGGCAAATATGTGGTGTGGCTGAAT
GAATACGGCATCAAAATCATGCGCTCCAAACTTCATCTCGAAAGCAGTGATTCGGACCACGCATGGAAGCGCATG
GCGCACATAGACAGACCTCAGACAGATGACTGGGAGACCATGGCCAGCGTCTGGAAGGGCCGAGCCGAGTGGATC
GACGACAAAGCCATCGGCAACGACGAAGCGGAGCCGAGAGCTTCTACCGATTCTCCCTCAGCCGTAGCTCCGAAG
CTTCGAGAGCAAGCCAACAGCAAGGCGATAGAACGGCTTCTCGTCGGCTGGGGCGGCACAATATGGATTATTCAC
GTTCATCCGGGCGCTGGTACTGGCAAGGGTTCCGGTCAAATGGCACTCGGACGAGCAGAAGTTGCCAAGATCTTC
CGAATGGACTGCATCATCTCCGGCATCTCGCTCTACACACAAAGTCTTTTACTTGTTCTCGCATTTTGTTCAGAT
GGCGATGATGCCAAAGTCAAGCAGAAGAGGAACTCGTCTCGAGGTTCGAAGCGACGCGCGCGTTCTGGGTCATTG
CAGTCTCTGACGGACCATCAACCGCCTGAGCTCCGGCTCATCGATCTCAGCTCACAGACGGAGGTGGACAAGATT
ATTCTCAGCATCAATCGCTATGAGCGGCTGTCTTCTGCCGACTATCACTTGAGCGTCCTGCCTGCTCGCACGGCC
GCATCTGCCGCCGCGTCCAAAGGAACTCTCGAGGCGCTTGCGGGTCTGGGTACCGACGTTTGGAATGCCGCCATC
AACCCCAAGTCTCTGTTCAGCTCCGGCGCGAGTATCAAGAGCAGGGACAGCGGTGACGATGGAGGGTCTGCCTCC
AAGACGGCGAGCATAGCGGGTACCATTCGGACTAGCAGACCTACGGTTTCGGCGGCTCATCCGAGCTTGGTGAAG
CCAGGGGCAAAGATCTTCATTCATAGCCCGTACGACTGCATATTGGCGACCAAAAGGGACCTGGCCGATCACTTG
TCGTGGCTTCTGGAGAATGAGCAGTTTCAGCGTGCCTGGGAGCTGCTGGACGAGAATCCAGACATTGTATCACCA
CCCATTGACAAGACGGGCGACGTGGCCTCCACGCCTTCGAAAACCCATTCGGCCGCGGACGACTTTTACGACGAC
GAGTCAGCCATGGACGCAACGAATAGAGCTGCCGTTTCTTTCGCCGAAAAGGAGAAGAGGCGGGTTGGCGAGCTC
TGGATCCAGGAGCTCATCGAAGATGGAGATTGGAAGGCAGCCGGCCAGGTGTGTGGCAAGGTGGTGACGACACCA
GATCGGTGGGAGAAATGGGTCTACACATTCGCCGGAGCAAACAGGTTTGACGAGATCGCGAACCACATGCCGTCA
CAGCCGCTGCTGCCGCCGCTTCCCTCGACGGTATACGAGGTGATACTGGGTCATTACCTTCAGAACAACAAGCCG
CGGTTCCAAGAACTTCTGGCCACTTGGTCGACGGATCTCTTCAACGTTGCTATCGTGAGCACGGCGTTAGAGAAC
CAGCTGAAATTCCGAGACGTGCGGGAAGATAGCATCGACGATGGGGTCAAAGGCAGAGACTGGCGTATCGTCATG
CAGAGCCTGTCGGGCCTTTATGAGGCCGGTGGGAGGAACAGAGAGGCGCTCAAGTGCTATATCAAGCTTCACGAT
GCCGATTCGGCGTTTCGAATGATCCGCGATGGCCATCTTGCCGAGGCGGTGGCCGACGACATACCGAGCTTCCTT
GGCCTGAGGGTTGATCCTGAGAAGCGGGACTCGATGACCAAGGAAGACTTGGCAGAAGCAACCTCGGAGGCCATC
ACGCTGCTCGTCGACGAAGCTCAACACGGTCTTGTCCGGCCCGAGACGGTGGTGAAACAACTCGAGGAGCAACAG
CTCGATCTCTACCTGTATTTCTATCTCAAGGGCCTGTGGCGCGGCGAGGGCATTCAGGAGCGAACGGGCGAGAAC
ATGGACCGACTGGTCATGGACAGCCAGTCGTTGGTAGACGACTTTGCCGACCTGGCCGTCCATCTGTTCTCCGTC
AACGACAGGCCGATGCTAATGGAGTTTCTCAAGTCGTCGACATCGTACACGTTTGAAAAGGCTGTCCAAGAATGC
GAGGACTTTAATTATCACGACGAGCTGGTTTACCTGTACTCCAAGACGGGCCAGGTGAAGCGTGCGCTCTTTCTA
ATTATCGACGGCTTGAAAAACGTTGAAAAGGCCATCGAGTTCGTCAAGGAACAAGACGACCTCGACCTGTGGGAG
GATCTGCTCACCTACAGCATGGATAAGCCTGCCTTCATCCGGGCCCTGCTCGAGCAGGTTGGGACCGTCATCAAT
CCGGTGAGGCTGGTTCGGCGGATACCAGAAGGGCTGGCGATCCAGGGACTCAAGGAGGGACTCATACACATGATG
AAGGAGCACGAACTGCAACACAGCATCAGTTCTGGGGCGGTACGCGTGCTGCGCAGCGAATTAGCGGCGGCTCAG
AATGAGCTGCGGGCAGGGCAGCGCCGAGGCATCAAGTTCGAGGTGGCGCCGCGTCCCGCCAGCGTTGCTGAGGGC
GACAAGCACGGCGTCGGAGAGCGGCAGGCTGGTCGTTGTGCGAAGTGCGAGGGGCCCCTTACGGAACTAGAGATG
GAATCGTTGGTCGGCTTCGCGTGCGGTCACGTCTTCCACGTCGGTCATCTGCTGGAGATGCTCGACGAGCGGCTG
GACACGGGACTCATCGACGTCGGTGGGGAGGGAATGGAAACAAGACGGCATTCTGTGGGTATGAAGGTGATGAGG
GCTCGGCTGCTCAGGGATAAGATCAAAGGCGGCTGTCCCATGTGCCAGCAAGTCAGCAAGCATTGA
Transcript >Ophcf2|05222
ATGACCGGACCGCCGCCAATCGAGAGCCGAGCTCACGGGGGGCCTGCCCACGGCGATGGGATCCAGCCAGCTGAC
ACTGCGAGCCGCGGCCGATCCCAGCAGAGGCAGCCGGCTGCGGAAGGACACGATAGCGGTTATACTGGCAATAAG
GCTGTCGAGGGGATCTCTTCGAGCGGCGAAGACGATGAAGACGACAGTGAAGATGCGGATGAGGACGAGGACGAG
GACGAGGATGAGGACGAGGAGCCGCAGCTCAAATACGCCCGCATGACGCAGCATTTGGCTGCCGTTTATCGCAAT
GGCGACGCAACCAGTGCTTTCCTCGTTGCTGGTGATAAGATGATCATAGGCACTCATAATGGCAACATCCACGTC
CTCCAGCTTCCGACTTTCCAGTCGCTACGGGTCTATCACGCTCATTCGGCGTCGGTAACGAGCATATCCATCTCT
CCGTACCCGCCTCCACTGCCTGGTGACAAGACGATTGTCTCTCTCCGCCCTCCCGTCTCGCATTCAAAGTCTGGT
ACCAGGCATTCGGAGACGCCTCCGTCAGCTGCGGCTTCGAGGAGGACCAGGGAGCCTCTGCCGCTGCCGAAGCTC
CCCTCCAACGAGATCTACATAGCAACTTCATCCATGGACGGCAATGTATGCATACAGTCTCTCACGGATATCAAA
GACGTTCAGCTCCGCAATTTCGCCCGTCCAATACAGACTGTCGCTCTCTCACCGGAGTACAAGCTCGACCGGACT
TATCTCTCAGGCGGCCTGGCAGGCCAACTTATCTTGACGGTAGGCGGCGGTCAGGGGCGAAGCACTTCCACCACG
ACGGGGACCGCTGCGGCCGCAGCTTCTGGCTGGCTTGGCAGCATGGGACTGGGTCACAACACTGGCAAAGACAGC
GTTCTTCACTCCGGAGAGGGTTCCATCAGCTGCATCAAGTGGTCTCTGTCCGGCAAATATGTGGTGTGGCTGAAT
GAATACGGCATCAAAATCATGCGCTCCAAACTTCATCTCGAAAGCAGTGATTCGGACCACGCATGGAAGCGCATG
GCGCACATAGACAGACCTCAGACAGATGACTGGGAGACCATGGCCAGCGTCTGGAAGGGCCGAGCCGAGTGGATC
GACGACAAAGCCATCGGCAACGACGAAGCGGAGCCGAGAGCTTCTACCGATTCTCCCTCAGCCGTAGCTCCGAAG
CTTCGAGAGCAAGCCAACAGCAAGGCGATAGAACGGCTTCTCGTCGGCTGGGGCGGCACAATATGGATTATTCAC
GTTCATCCGGGCGCTGGTACTGGCAAGGGTTCCGGTCAAATGGCACTCGGACGAGCAGAAGTTGCCAAGATCTTC
CGAATGGACTGCATCATCTCCGGCATCTCGCTCTACACACAAAGTCTTTTACTTGTTCTCGCATTTTGTTCAGAT
GGCGATGATGCCAAAGTCAAGCAGAAGAGGAACTCGTCTCGAGGTTCGAAGCGACGCGCGCGTTCTGGGTCATTG
CAGTCTCTGACGGACCATCAACCGCCTGAGCTCCGGCTCATCGATCTCAGCTCACAGACGGAGGTGGACAAGATT
ATTCTCAGCATCAATCGCTATGAGCGGCTGTCTTCTGCCGACTATCACTTGAGCGTCCTGCCTGCTCGCACGGCC
GCATCTGCCGCCGCGTCCAAAGGAACTCTCGAGGCGCTTGCGGGTCTGGGTACCGACGTTTGGAATGCCGCCATC
AACCCCAAGTCTCTGTTCAGCTCCGGCGCGAGTATCAAGAGCAGGGACAGCGGTGACGATGGAGGGTCTGCCTCC
AAGACGGCGAGCATAGCGGGTACCATTCGGACTAGCAGACCTACGGTTTCGGCGGCTCATCCGAGCTTGGTGAAG
CCAGGGGCAAAGATCTTCATTCATAGCCCGTACGACTGCATATTGGCGACCAAAAGGGACCTGGCCGATCACTTG
TCGTGGCTTCTGGAGAATGAGCAGTTTCAGCGTGCCTGGGAGCTGCTGGACGAGAATCCAGACATTGTATCACCA
CCCATTGACAAGACGGGCGACGTGGCCTCCACGCCTTCGAAAACCCATTCGGCCGCGGACGACTTTTACGACGAC
GAGTCAGCCATGGACGCAACGAATAGAGCTGCCGTTTCTTTCGCCGAAAAGGAGAAGAGGCGGGTTGGCGAGCTC
TGGATCCAGGAGCTCATCGAAGATGGAGATTGGAAGGCAGCCGGCCAGGTGTGTGGCAAGGTGGTGACGACACCA
GATCGGTGGGAGAAATGGGTCTACACATTCGCCGGAGCAAACAGGTTTGACGAGATCGCGAACCACATGCCGTCA
CAGCCGCTGCTGCCGCCGCTTCCCTCGACGGTATACGAGGTGATACTGGGTCATTACCTTCAGAACAACAAGCCG
CGGTTCCAAGAACTTCTGGCCACTTGGTCGACGGATCTCTTCAACGTTGCTATCGTGAGCACGGCGTTAGAGAAC
CAGCTGAAATTCCGAGACGTGCGGGAAGATAGCATCGACGATGGGGTCAAAGGCAGAGACTGGCGTATCGTCATG
CAGAGCCTGTCGGGCCTTTATGAGGCCGGTGGGAGGAACAGAGAGGCGCTCAAGTGCTATATCAAGCTTCACGAT
GCCGATTCGGCGTTTCGAATGATCCGCGATGGCCATCTTGCCGAGGCGGTGGCCGACGACATACCGAGCTTCCTT
GGCCTGAGGGTTGATCCTGAGAAGCGGGACTCGATGACCAAGGAAGACTTGGCAGAAGCAACCTCGGAGGCCATC
ACGCTGCTCGTCGACGAAGCTCAACACGGTCTTGTCCGGCCCGAGACGGTGGTGAAACAACTCGAGGAGCAACAG
CTCGATCTCTACCTGTATTTCTATCTCAAGGGCCTGTGGCGCGGCGAGGGCATTCAGGAGCGAACGGGCGAGAAC
ATGGACCGACTGGTCATGGACAGCCAGTCGTTGGTAGACGACTTTGCCGACCTGGCCGTCCATCTGTTCTCCGTC
AACGACAGGCCGATGCTAATGGAGTTTCTCAAGTCGTCGACATCGTACACGTTTGAAAAGGCTGTCCAAGAATGC
GAGGACTTTAATTATCACGACGAGCTGGTTTACCTGTACTCCAAGACGGGCCAGGTGAAGCGTGCGCTCTTTCTA
ATTATCGACGGCTTGAAAAACGTTGAAAAGGCCATCGAGTTCGTCAAGGAACAAGACGACCTCGACCTGTGGGAG
GATCTGCTCACCTACAGCATGGATAAGCCTGCCTTCATCCGGGCCCTGCTCGAGCAGGTTGGGACCGTCATCAAT
CCGGTGAGGCTGGTTCGGCGGATACCAGAAGGGCTGGCGATCCAGGGACTCAAGGAGGGACTCATACACATGATG
AAGGAGCACGAACTGCAACACAGCATCAGTTCTGGGGCGGTACGCGTGCTGCGCAGCGAATTAGCGGCGGCTCAG
AATGAGCTGCGGGCAGGGCAGCGCCGAGGCATCAAGTTCGAGGTGGCGCCGCGTCCCGCCAGCGTTGCTGAGGGC
GACAAGCACGGCGTCGGAGAGCGGCAGGCTGGTCGTTGTGCGAAGTGCGAGGGGCCCCTTACGGAACTAGAGATG
GAATCGTTGGTCGGCTTCGCGTGCGGTCACGTCTTCCACGTCGGTCATCTGCTGGAGATGCTCGACGAGCGGCTG
GACACGGGACTCATCGACGTCGGTGGGGAGGGAATGGAAACAAGACGGCATTCTGTGGGTATGAAGGTGATGAGG
GCTCGGCTGCTCAGGGATAAGATCAAAGGCGGCTGTCCCATGTGCCAGCAAGTCAGCAAGCATTGA
Gene >Ophcf2|05222
ATGACCGGACCGCCGCCAATCGAGAGCCGAGCTCACGGGGGGCCTGCCCACGGCGATGGGATCCAGCCAGCTGAC
ACTGCGAGCCGCGGCCGATCCCAGCAGAGGCAGCCGGCTGCGGAAGGACACGATAGCGGTTATACTGGCAATAAG
GCTGTCGAGGGGATCTCTTCGAGCGGCGAAGACGATGAAGACGACAGTGAAGATGCGGATGAGGACGAGGACGAG
GACGAGGATGAGGACGAGGAGCCGCAGCTCAAATACGCCCGCATGACGCAGCATTTGGCTGCCGTTTATCGCAAT
GGCGACGCAACCAGTGCTTTCCTCGTTGCTGGTGATAAGATGGTGTGCTCTGCTCGTCCCTTTTCGTGTACAACG
GTCTCTTTCTTACAAATATCCTAGATCATAGGCACTCATAATGGCAACATCGTTAGTAGACCCGTTTCCATTTCC
CTGGCCTGCACTAACCTACCGTGCAGCACGTCCTCCAGCTTCCGACTTTCCAGTCGCTACGGGTCTATCACGCTC
ATTCGGCGTCGGTAACGAGCATATCCATCTCTCCGTACCCGCCTCCACTGCCTGGTGACAAGACGATTGTCTCTC
TCCGCCCTCCCGTCTCGCATTCAAAGTCTGGTACCAGGCATTCGGAGACGCCTCCGTCAGCTGCGGCTTCGAGGA
GGACCAGGGAGCCTCTGCCGCTGCCGAAGCTCCCCTCCAACGAGATCTACATAGCAACTTCATCCATGGACGGCA
ATGTATGCATACAGTCTCTCACGGATATCAAAGACGTTCAGCTCCGCAATTTCGCCCGTCCAATACAGACTGTCG
CTCTCTCACCGGAGTACAAGCTCGACCGGACTTATCTCTCAGGCGGCCTGGCAGGCCAACTTATCTTGACGGTAG
GCGGCGGTCAGGGGCGAAGCACTTCCACCACGACGGGGACCGCTGCGGCCGCAGCTTCTGGCTGGCTTGGCAGCA
TGGGACTGGGTCACAACACTGGCAAAGACAGCGTTCTTCACTCCGGAGAGGGTTCCATCAGCTGCATCAAGTGGT
CTCTGTCCGGCAAATATGTGGTGTGGCTGAATGAATACGGCATCAAAATCATGCGCTCCAAACTTCATCTCGAAA
GCAGTGATTCGGACCACGCATGGAAGCGCATGGCGCACATAGACAGACCTCAGACAGATGACTGGGAGACCATGG
CCAGCGTCTGGAAGGGCCGAGCCGAGTGGATCGACGACAAAGCCATCGGCAACGACGAAGCGGAGCCGAGAGCTT
CTACCGATTCTCCCTCAGCCGTAGCTCCGAAGCTTCGAGAGCAAGCCAACAGCAAGGCGATAGAACGGCTTCTCG
TCGGCTGGGGCGGCACAATATGGATTATTCACGTTCATCCGGGCGCTGGTACTGGCAAGGGTTCCGGTCAAATGG
CACTCGGACGAGCAGAAGTTGCCAAGATGTGAGTCCAGAGTATCGTGGTTGATTTGGCAATTGCTCTAATACACA
TCAGCTTCCGAATGGACTGCATCATCTCCGGCATCTCGCTCTACACACAAAGTCTTTTACTTGTTCTCGCATTTT
GTTCAGATGGCGATGATGCCAAAGTCAAGCAGAAGAGGAACTCGTCTCGAGGTTCGAAGCGACGCGCGCGTTCTG
GGTCATTGCAGTCTCTGACGGACCATCAACCGCCTGAGCTCCGGCTCATCGATCTCAGCTCACAGACGGAGGTGG
ACAAGATTATTCTCAGCATCAATCGCTATGAGCGGCTGTCTTCTGCCGACTATCACTTGAGCGTCCTGCCTGCTC
GCACGGCCGCATCTGCCGCCGCGTCCAAAGGAACTCTCGAGGCGCTTGCGGGTCTGGGTACCGACGTTTGGAATG
CCGCCATCAACCCCAAGTCTCTGTTCAGCTCCGGCGCGAGTATCAAGAGCAGGGACAGCGGTGACGATGGAGGGT
CTGCCTCCAAGACGGCGAGCATAGCGGGTACCATTCGGACTAGCAGACCTACGGTTTCGGCGGCTCATCCGAGCT
TGGTGAAGCCAGGGGCAAAGATCTTCATTCATAGCCCGTACGACTGCATATTGGCGACCAAAAGGGACCTGGCCG
ATCACTTGTCGTGGCTTCTGGAGAATGAGCAGTTTCAGCGTGCCTGGGAGCTGCTGGACGAGAATCCAGACATTG
TATCACCACCCATTGACAAGACGGGCGACGTGGCCTCCACGCCTTCGAAAACCCATTCGGCCGCGGACGACTTTT
ACGACGACGAGTCAGCCATGGACGCAACGAATAGAGCTGCCGTTTCTTTCGCCGAAAAGGAGAAGAGGCGGGTTG
GCGAGCTCTGGATCCAGGAGCTCATCGAAGATGGAGATTGGAAGGCAGCCGGCCAGGTGTGTGGCAAGGTGGTGA
CGACACCAGATCGGTGGGAGAAATGGGTCTACACATTCGCCGGAGCAAACAGGTTTGACGAGATCGCGAACCACA
TGCCGTCACAGCCGCTGCTGCCGCCGCTTCCCTCGACGGTATACGAGGTGATACTGGGTCATTACCTTCAGAACA
ACAAGCCGCGGTTCCAAGAACTTCTGGCCACTTGGTCGACGGATCTCTTCAACGTTGCTATCGTGAGCACGGCGT
TAGAGAACCAGCTGAAATTCCGAGACGTGCGGGAAGATAGCATCGACGATGGGGTCAAAGGCAGAGACTGGCGTA
TCGTCATGCAGAGCCTGTCGGGCCTTTATGAGGCCGGTGGGAGGAACAGAGAGGCGCTCAAGTGCTATATCAAGC
TTCACGATGCCGATTCGGCGTTTCGAATGATCCGCGATGGCCATCTTGCCGAGGCGGTGGCCGACGACATACCGA
GCTTCCTTGGCCTGAGGGTTGATCCTGAGAAGCGGGACTCGATGACCAAGGAAGACTTGGCAGAAGCAACCTCGG
AGGCCATCACGCTGCTCGTCGACGAAGCTCAACACGGTCTTGTCCGGCCCGAGACGGTGGTGAAACAACTCGAGG
AGCAACAGCTCGATCTCTACCTGTATTTCTATCTCAAGGGCCTGTGGCGCGGCGAGGGCATTCAGGAGCGAACGG
GCGAGAACATGGACCGACTGGTCATGGACAGCCAGTCGTTGGTAGACGACTTTGCCGACCTGGCCGTCCATCTGT
TCTCCGTCAACGACAGGCCGATGCTAATGGAGTTTCTCAAGTCGTCGACATCGTACACGTTTGAAAAGGTAAGCT
AGCAGCCGTTTGAGAAGCGAGGGTCAATAGCTGACGTTCAACAGGCTGTCCAAGAATGCGAGGACTTTAATTATC
ACGACGAGCTGGTTTACCTGTACTCCAAGACGGGCCAGGTGAAGCGTGCGCTCTTTCTAATTATCGACGGCTTGA
AAAACGTTGAAAAGGCCATCGAGTTCGTCAAGGAACAAGACGACCTCGACCTGTGGGAGGATCTGCTCACCTACA
GCATGGATAAGCCTGCCTTCATCCGGGCCCTGCTCGAGCAGGTTGGGACCGTCATCAATCCGGTGAGGCTGGTTC
GGCGGATACCAGAAGGGCTGGCGATCCAGGGACTCAAGGAGGGACTCATACACATGATGAAGGAGCACGAACTGC
AACACAGCATCAGTTCTGGGGCGGTACGCGTGCTGCGCAGCGAATTAGCGGCGGCTCAGAATGAGCTGCGGGCAG
GGCAGCGCCGAGGCATCAAGTTCGAGGTGGCGCCGCGTCCCGCCAGCGTTGCTGAGGGCGACAAGCACGGCGTCG
GAGAGCGGCAGGCTGGTCGTTGTGCGAAGTGCGAGGGGCCCCTTACGGAACTAGAGATGGAATCGTTGGTCGGCT
TCGCGTGCGGTCACGTCTTCCACGTCGGTCATCTGCTGGAGATGCTCGACGAGCGGCTGGACACGGGACTCATCG
ACGTCGGTGGGGAGGGAATGGAAACAAGACGGCATTCTGTGGGTATGAAGGTGATGAGGGCTCGGCTGCTCAGGG
ATAAGATCAAAGGCGGCTGTCCCATGTGCCAGCAAGTCAGCAAGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail