Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05218
Gene name
Locationscaffold_05:2803387..2806597
Strand+
Gene length (bp)3210
Transcript length (bp)3210
Coding sequence length (bp)3210
Protein length (aa) 1070

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 2.1E-16 349 433

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5148 0.8127 0.0912 0.0677 0.0302 0.0021 0.0865 0.0188 0.0266 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2687
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2565
Ophiocordyceps australis map64 (Brazil) OphauB2|6611
Ophiocordyceps camponoti-floridani Ophcf2|05218 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4251
Ophiocordyceps kimflemingae Ophio5|7960
Ophiocordyceps subramaniannii Hirsu2|4193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05218
MSAWMNDAVSSHNGNGFSHMTDPNAMMDPSAFMSNHAQLNQNQYTNQPQQMAGIPNGPLRHGSPTGGYHAHGQSH
NPPNPGYQTTSVIPSKRPRAREDSISGSPRQNPGMLPPSRSETPQQPSFAGFQAQQNPAQYPHLQPNGSANASPS
PIMGNQMRHVSVPQRVATASPHPFSPGAQQFSQTSPVPSEHGTPQPNTYMQGIAPGYNPGFAPSPSNPRTLPNPM
SGAGQMMPQHMGQVPPQHVGQMPPNMYQQQHHHLQQGQPQPQPQQQLQQQQRPPNVTDQQKMATYQMRLQQQLQG
NMQMQAQMQAHGMGRGVLPKQQMPGVPNGQMPSGGMRPQPRPMNAINPEHFMKNLTALMNAKGLPLDPNPVICDR
PVPLVYLFQAVTSRGGLKAVTAANGWLQVAQTLGLPVQNPTAAPMLRQVYERNLQKFEEVWMAQQKQRIQQGAGM
VGPGTPQKQIHAMGSGHLLPGQQHPHMPSQHQQPPPHQPPPPPHQQQQQQQQQQQQQVAAKPGQTAVNGFPGLPS
QQPGVGVAPGRSSLSGGMDGSAMEYSVQSPAHHRPGSLSLSQGEGGAPEPIFASSLHSTADLPIQRNCDKTDEYI
PCARELSTYGGMDMQMANMLGMELDRWNPFVPSVHELGNIDIHALTRSLQSGIHGEVRLALDTLAAVSSSPSQLH
FMQLRYCDDLIDVLLDCADDQLDLLAEHTVEESDEILLQPYEDVVRACRLERWAIKEVPVFGSTEYDLDRAVDRL
ICITTILRNFSFPGDQNDNHNFLSDESVTKMICVVIRYLGTRTMLLRTHRNTLDFMKDVVILLSNIASSVELPGR
EQALCLLHFLLSFAPTPGPTTANDTLFFPPYEPDLHTYTPHAVDALAKLLARDEPNRALYRFIFASDANGSELLT
RTFAMAISPILDKPDQPHRLTAFPSRIEQRKPFLMQGLLVGEILASLAPGAESGIARSWLASGSGLAQNLYRIIQ
ELSVMYERPQVVNRPPGRMHSPRDPELVYIVVVTVALLKRLIDKAGDPNQPGEIPGDLLPQQQLLVNALTMQSPD
WTKEGMLLQLTSIFKHCQF*
Coding >Ophcf2|05218
ATGAGCGCCTGGATGAACGACGCCGTCTCGAGCCACAATGGAAACGGTTTTTCGCACATGACCGACCCCAACGCC
ATGATGGACCCATCAGCCTTCATGTCCAACCACGCTCAGCTTAATCAGAACCAATATACGAACCAGCCTCAGCAG
ATGGCCGGCATTCCGAATGGCCCCTTGCGCCACGGCTCGCCGACCGGCGGCTACCACGCCCATGGCCAGAGCCAC
AACCCTCCCAACCCTGGCTATCAGACGACTTCCGTCATCCCCTCGAAACGCCCTCGCGCGCGAGAAGATAGCATC
AGCGGCTCTCCCAGACAGAATCCGGGCATGCTGCCGCCGTCGCGATCCGAAACCCCCCAGCAGCCAAGCTTTGCC
GGTTTCCAGGCGCAGCAGAATCCAGCTCAGTATCCGCATCTTCAACCAAATGGTTCCGCCAACGCAAGCCCGTCG
CCAATTATGGGCAACCAGATGCGGCACGTCAGCGTACCGCAACGAGTCGCAACTGCCTCGCCTCACCCCTTCTCG
CCGGGCGCGCAGCAGTTCTCGCAGACGTCGCCCGTGCCCTCTGAACACGGTACCCCCCAACCGAACACGTACATG
CAGGGCATCGCCCCGGGCTATAACCCCGGTTTCGCGCCGTCGCCATCGAACCCTCGAACTCTGCCGAACCCAATG
TCTGGCGCCGGCCAGATGATGCCGCAACACATGGGTCAAGTACCGCCGCAGCACGTGGGTCAGATGCCCCCCAAC
ATGTACCAGCAGCAGCATCATCACCTGCAGCAGGGCCAGCCACAGCCGCAGCCGCAGCAGCAATTGCAGCAGCAG
CAACGGCCGCCGAACGTGACGGATCAGCAAAAGATGGCGACGTACCAGATGCGGCTCCAGCAACAGTTGCAGGGC
AACATGCAGATGCAGGCGCAGATGCAGGCTCATGGCATGGGCCGCGGAGTGCTGCCGAAGCAGCAGATGCCCGGC
GTGCCCAACGGGCAGATGCCCTCCGGTGGCATGCGTCCGCAGCCCAGACCGATGAACGCCATCAACCCGGAGCAC
TTCATGAAGAACCTTACTGCGCTGATGAACGCCAAAGGACTCCCTCTCGATCCGAATCCTGTCATCTGCGATCGT
CCGGTGCCCCTCGTCTACCTCTTTCAGGCGGTGACATCAAGAGGAGGCCTAAAGGCGGTGACGGCGGCCAACGGA
TGGCTCCAGGTTGCCCAGACCCTCGGGTTGCCAGTGCAGAATCCGACAGCGGCGCCGATGCTCAGGCAGGTGTAC
GAGCGCAACTTGCAGAAGTTCGAAGAGGTCTGGATGGCTCAACAGAAGCAGAGGATACAGCAGGGCGCAGGCATG
GTCGGCCCTGGAACACCCCAGAAACAAATACATGCCATGGGCTCGGGGCATCTGCTGCCGGGACAGCAACACCCA
CATATGCCTTCCCAACATCAGCAGCCGCCTCCCCACCAGCCGCCGCCGCCGCCGCATCAACAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGGTGGCTGCGAAGCCCGGCCAGACCGCCGTCAATGGTTTTCCGGGTCTTCCGTCC
CAGCAGCCTGGCGTTGGTGTTGCTCCCGGCAGGAGTAGTTTGTCTGGTGGGATGGACGGCTCGGCGATGGAGTAC
TCGGTGCAGTCTCCGGCGCATCACAGACCCGGCAGTCTGTCTCTAAGTCAGGGCGAAGGCGGCGCACCCGAACCT
ATTTTTGCTTCCAGCCTCCACTCCACCGCAGACCTGCCAATACAGCGAAACTGCGATAAGACAGACGAGTACATA
CCGTGTGCGAGGGAATTGTCAACGTACGGCGGAATGGATATGCAGATGGCCAATATGCTGGGGATGGAGCTGGAC
CGGTGGAATCCTTTCGTCCCATCGGTGCACGAACTCGGAAACATCGACATTCATGCACTGACGCGGAGCCTCCAA
AGTGGCATCCACGGCGAGGTCCGCCTCGCGCTGGATACGTTGGCAGCGGTGTCGTCTTCGCCGAGTCAGCTGCAC
TTTATGCAACTGAGATACTGCGACGACTTGATCGACGTGCTACTGGACTGTGCCGATGACCAGCTCGACCTGCTG
GCCGAGCACACCGTCGAGGAGTCAGACGAGATACTGCTGCAACCGTACGAGGACGTGGTCCGGGCTTGTCGGCTG
GAGCGATGGGCCATCAAGGAGGTGCCGGTCTTTGGAAGCACCGAGTACGACCTCGATCGCGCCGTTGACCGACTG
ATATGCATCACCACCATCCTGCGCAACTTCTCCTTCCCCGGCGACCAAAACGACAATCACAACTTTTTGTCGGAC
GAGTCCGTCACCAAGATGATCTGCGTCGTTATCCGCTATCTCGGCACTCGTACAATGCTGCTCCGCACGCACCGC
AACACTCTGGATTTCATGAAGGACGTCGTCATCCTGCTTTCCAACATCGCGAGCTCGGTGGAGCTGCCCGGACGG
GAGCAGGCGTTGTGTCTGCTGCACTTCCTGCTGTCGTTCGCCCCAACGCCTGGTCCGACGACGGCCAACGATACC
CTCTTCTTCCCGCCCTACGAACCGGACCTTCACACCTACACGCCTCACGCGGTCGACGCGCTAGCCAAGCTGCTG
GCTCGAGATGAACCGAATCGGGCCTTGTACCGGTTCATCTTCGCCTCTGACGCCAACGGCTCTGAGCTGCTCACG
AGGACGTTTGCCATGGCCATATCACCAATACTCGATAAGCCCGACCAGCCGCACCGGCTGACGGCGTTCCCCTCG
CGCATCGAGCAGCGTAAGCCGTTCCTAATGCAGGGCCTCCTCGTGGGCGAGATCCTCGCATCACTGGCGCCCGGC
GCCGAGTCCGGCATCGCACGGAGCTGGCTGGCGTCGGGCAGCGGCCTCGCTCAGAATCTGTACCGCATCATCCAG
GAGCTCAGCGTTATGTACGAGCGGCCGCAGGTGGTGAATCGGCCTCCCGGTCGGATGCACTCGCCTCGAGATCCG
GAATTGGTATATATCGTCGTCGTCACGGTCGCCCTCCTCAAGAGGCTAATTGACAAGGCCGGCGACCCTAACCAG
CCTGGTGAGATCCCTGGCGACTTATTGCCGCAGCAGCAGCTTCTCGTCAACGCGTTGACGATGCAGTCGCCCGAC
TGGACAAAGGAGGGCATGCTCCTGCAACTGACGTCCATATTCAAGCATTGCCAGTTTTAG
Transcript >Ophcf2|05218
ATGAGCGCCTGGATGAACGACGCCGTCTCGAGCCACAATGGAAACGGTTTTTCGCACATGACCGACCCCAACGCC
ATGATGGACCCATCAGCCTTCATGTCCAACCACGCTCAGCTTAATCAGAACCAATATACGAACCAGCCTCAGCAG
ATGGCCGGCATTCCGAATGGCCCCTTGCGCCACGGCTCGCCGACCGGCGGCTACCACGCCCATGGCCAGAGCCAC
AACCCTCCCAACCCTGGCTATCAGACGACTTCCGTCATCCCCTCGAAACGCCCTCGCGCGCGAGAAGATAGCATC
AGCGGCTCTCCCAGACAGAATCCGGGCATGCTGCCGCCGTCGCGATCCGAAACCCCCCAGCAGCCAAGCTTTGCC
GGTTTCCAGGCGCAGCAGAATCCAGCTCAGTATCCGCATCTTCAACCAAATGGTTCCGCCAACGCAAGCCCGTCG
CCAATTATGGGCAACCAGATGCGGCACGTCAGCGTACCGCAACGAGTCGCAACTGCCTCGCCTCACCCCTTCTCG
CCGGGCGCGCAGCAGTTCTCGCAGACGTCGCCCGTGCCCTCTGAACACGGTACCCCCCAACCGAACACGTACATG
CAGGGCATCGCCCCGGGCTATAACCCCGGTTTCGCGCCGTCGCCATCGAACCCTCGAACTCTGCCGAACCCAATG
TCTGGCGCCGGCCAGATGATGCCGCAACACATGGGTCAAGTACCGCCGCAGCACGTGGGTCAGATGCCCCCCAAC
ATGTACCAGCAGCAGCATCATCACCTGCAGCAGGGCCAGCCACAGCCGCAGCCGCAGCAGCAATTGCAGCAGCAG
CAACGGCCGCCGAACGTGACGGATCAGCAAAAGATGGCGACGTACCAGATGCGGCTCCAGCAACAGTTGCAGGGC
AACATGCAGATGCAGGCGCAGATGCAGGCTCATGGCATGGGCCGCGGAGTGCTGCCGAAGCAGCAGATGCCCGGC
GTGCCCAACGGGCAGATGCCCTCCGGTGGCATGCGTCCGCAGCCCAGACCGATGAACGCCATCAACCCGGAGCAC
TTCATGAAGAACCTTACTGCGCTGATGAACGCCAAAGGACTCCCTCTCGATCCGAATCCTGTCATCTGCGATCGT
CCGGTGCCCCTCGTCTACCTCTTTCAGGCGGTGACATCAAGAGGAGGCCTAAAGGCGGTGACGGCGGCCAACGGA
TGGCTCCAGGTTGCCCAGACCCTCGGGTTGCCAGTGCAGAATCCGACAGCGGCGCCGATGCTCAGGCAGGTGTAC
GAGCGCAACTTGCAGAAGTTCGAAGAGGTCTGGATGGCTCAACAGAAGCAGAGGATACAGCAGGGCGCAGGCATG
GTCGGCCCTGGAACACCCCAGAAACAAATACATGCCATGGGCTCGGGGCATCTGCTGCCGGGACAGCAACACCCA
CATATGCCTTCCCAACATCAGCAGCCGCCTCCCCACCAGCCGCCGCCGCCGCCGCATCAACAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGGTGGCTGCGAAGCCCGGCCAGACCGCCGTCAATGGTTTTCCGGGTCTTCCGTCC
CAGCAGCCTGGCGTTGGTGTTGCTCCCGGCAGGAGTAGTTTGTCTGGTGGGATGGACGGCTCGGCGATGGAGTAC
TCGGTGCAGTCTCCGGCGCATCACAGACCCGGCAGTCTGTCTCTAAGTCAGGGCGAAGGCGGCGCACCCGAACCT
ATTTTTGCTTCCAGCCTCCACTCCACCGCAGACCTGCCAATACAGCGAAACTGCGATAAGACAGACGAGTACATA
CCGTGTGCGAGGGAATTGTCAACGTACGGCGGAATGGATATGCAGATGGCCAATATGCTGGGGATGGAGCTGGAC
CGGTGGAATCCTTTCGTCCCATCGGTGCACGAACTCGGAAACATCGACATTCATGCACTGACGCGGAGCCTCCAA
AGTGGCATCCACGGCGAGGTCCGCCTCGCGCTGGATACGTTGGCAGCGGTGTCGTCTTCGCCGAGTCAGCTGCAC
TTTATGCAACTGAGATACTGCGACGACTTGATCGACGTGCTACTGGACTGTGCCGATGACCAGCTCGACCTGCTG
GCCGAGCACACCGTCGAGGAGTCAGACGAGATACTGCTGCAACCGTACGAGGACGTGGTCCGGGCTTGTCGGCTG
GAGCGATGGGCCATCAAGGAGGTGCCGGTCTTTGGAAGCACCGAGTACGACCTCGATCGCGCCGTTGACCGACTG
ATATGCATCACCACCATCCTGCGCAACTTCTCCTTCCCCGGCGACCAAAACGACAATCACAACTTTTTGTCGGAC
GAGTCCGTCACCAAGATGATCTGCGTCGTTATCCGCTATCTCGGCACTCGTACAATGCTGCTCCGCACGCACCGC
AACACTCTGGATTTCATGAAGGACGTCGTCATCCTGCTTTCCAACATCGCGAGCTCGGTGGAGCTGCCCGGACGG
GAGCAGGCGTTGTGTCTGCTGCACTTCCTGCTGTCGTTCGCCCCAACGCCTGGTCCGACGACGGCCAACGATACC
CTCTTCTTCCCGCCCTACGAACCGGACCTTCACACCTACACGCCTCACGCGGTCGACGCGCTAGCCAAGCTGCTG
GCTCGAGATGAACCGAATCGGGCCTTGTACCGGTTCATCTTCGCCTCTGACGCCAACGGCTCTGAGCTGCTCACG
AGGACGTTTGCCATGGCCATATCACCAATACTCGATAAGCCCGACCAGCCGCACCGGCTGACGGCGTTCCCCTCG
CGCATCGAGCAGCGTAAGCCGTTCCTAATGCAGGGCCTCCTCGTGGGCGAGATCCTCGCATCACTGGCGCCCGGC
GCCGAGTCCGGCATCGCACGGAGCTGGCTGGCGTCGGGCAGCGGCCTCGCTCAGAATCTGTACCGCATCATCCAG
GAGCTCAGCGTTATGTACGAGCGGCCGCAGGTGGTGAATCGGCCTCCCGGTCGGATGCACTCGCCTCGAGATCCG
GAATTGGTATATATCGTCGTCGTCACGGTCGCCCTCCTCAAGAGGCTAATTGACAAGGCCGGCGACCCTAACCAG
CCTGGTGAGATCCCTGGCGACTTATTGCCGCAGCAGCAGCTTCTCGTCAACGCGTTGACGATGCAGTCGCCCGAC
TGGACAAAGGAGGGCATGCTCCTGCAACTGACGTCCATATTCAAGCATTGCCAGTTTTAG
Gene >Ophcf2|05218
ATGAGCGCCTGGATGAACGACGCCGTCTCGAGCCACAATGGAAACGGTTTTTCGCACATGACCGACCCCAACGCC
ATGATGGACCCATCAGCCTTCATGTCCAACCACGCTCAGCTTAATCAGAACCAATATACGAACCAGCCTCAGCAG
ATGGCCGGCATTCCGAATGGCCCCTTGCGCCACGGCTCGCCGACCGGCGGCTACCACGCCCATGGCCAGAGCCAC
AACCCTCCCAACCCTGGCTATCAGACGACTTCCGTCATCCCCTCGAAACGCCCTCGCGCGCGAGAAGATAGCATC
AGCGGCTCTCCCAGACAGAATCCGGGCATGCTGCCGCCGTCGCGATCCGAAACCCCCCAGCAGCCAAGCTTTGCC
GGTTTCCAGGCGCAGCAGAATCCAGCTCAGTATCCGCATCTTCAACCAAATGGTTCCGCCAACGCAAGCCCGTCG
CCAATTATGGGCAACCAGATGCGGCACGTCAGCGTACCGCAACGAGTCGCAACTGCCTCGCCTCACCCCTTCTCG
CCGGGCGCGCAGCAGTTCTCGCAGACGTCGCCCGTGCCCTCTGAACACGGTACCCCCCAACCGAACACGTACATG
CAGGGCATCGCCCCGGGCTATAACCCCGGTTTCGCGCCGTCGCCATCGAACCCTCGAACTCTGCCGAACCCAATG
TCTGGCGCCGGCCAGATGATGCCGCAACACATGGGTCAAGTACCGCCGCAGCACGTGGGTCAGATGCCCCCCAAC
ATGTACCAGCAGCAGCATCATCACCTGCAGCAGGGCCAGCCACAGCCGCAGCCGCAGCAGCAATTGCAGCAGCAG
CAACGGCCGCCGAACGTGACGGATCAGCAAAAGATGGCGACGTACCAGATGCGGCTCCAGCAACAGTTGCAGGGC
AACATGCAGATGCAGGCGCAGATGCAGGCTCATGGCATGGGCCGCGGAGTGCTGCCGAAGCAGCAGATGCCCGGC
GTGCCCAACGGGCAGATGCCCTCCGGTGGCATGCGTCCGCAGCCCAGACCGATGAACGCCATCAACCCGGAGCAC
TTCATGAAGAACCTTACTGCGCTGATGAACGCCAAAGGACTCCCTCTCGATCCGAATCCTGTCATCTGCGATCGT
CCGGTGCCCCTCGTCTACCTCTTTCAGGCGGTGACATCAAGAGGAGGCCTAAAGGCGGTGACGGCGGCCAACGGA
TGGCTCCAGGTTGCCCAGACCCTCGGGTTGCCAGTGCAGAATCCGACAGCGGCGCCGATGCTCAGGCAGGTGTAC
GAGCGCAACTTGCAGAAGTTCGAAGAGGTCTGGATGGCTCAACAGAAGCAGAGGATACAGCAGGGCGCAGGCATG
GTCGGCCCTGGAACACCCCAGAAACAAATACATGCCATGGGCTCGGGGCATCTGCTGCCGGGACAGCAACACCCA
CATATGCCTTCCCAACATCAGCAGCCGCCTCCCCACCAGCCGCCGCCGCCGCCGCATCAACAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGGTGGCTGCGAAGCCCGGCCAGACCGCCGTCAATGGTTTTCCGGGTCTTCCGTCC
CAGCAGCCTGGCGTTGGTGTTGCTCCCGGCAGGAGTAGTTTGTCTGGTGGGATGGACGGCTCGGCGATGGAGTAC
TCGGTGCAGTCTCCGGCGCATCACAGACCCGGCAGTCTGTCTCTAAGTCAGGGCGAAGGCGGCGCACCCGAACCT
ATTTTTGCTTCCAGCCTCCACTCCACCGCAGACCTGCCAATACAGCGAAACTGCGATAAGACAGACGAGTACATA
CCGTGTGCGAGGGAATTGTCAACGTACGGCGGAATGGATATGCAGATGGCCAATATGCTGGGGATGGAGCTGGAC
CGGTGGAATCCTTTCGTCCCATCGGTGCACGAACTCGGAAACATCGACATTCATGCACTGACGCGGAGCCTCCAA
AGTGGCATCCACGGCGAGGTCCGCCTCGCGCTGGATACGTTGGCAGCGGTGTCGTCTTCGCCGAGTCAGCTGCAC
TTTATGCAACTGAGATACTGCGACGACTTGATCGACGTGCTACTGGACTGTGCCGATGACCAGCTCGACCTGCTG
GCCGAGCACACCGTCGAGGAGTCAGACGAGATACTGCTGCAACCGTACGAGGACGTGGTCCGGGCTTGTCGGCTG
GAGCGATGGGCCATCAAGGAGGTGCCGGTCTTTGGAAGCACCGAGTACGACCTCGATCGCGCCGTTGACCGACTG
ATATGCATCACCACCATCCTGCGCAACTTCTCCTTCCCCGGCGACCAAAACGACAATCACAACTTTTTGTCGGAC
GAGTCCGTCACCAAGATGATCTGCGTCGTTATCCGCTATCTCGGCACTCGTACAATGCTGCTCCGCACGCACCGC
AACACTCTGGATTTCATGAAGGACGTCGTCATCCTGCTTTCCAACATCGCGAGCTCGGTGGAGCTGCCCGGACGG
GAGCAGGCGTTGTGTCTGCTGCACTTCCTGCTGTCGTTCGCCCCAACGCCTGGTCCGACGACGGCCAACGATACC
CTCTTCTTCCCGCCCTACGAACCGGACCTTCACACCTACACGCCTCACGCGGTCGACGCGCTAGCCAAGCTGCTG
GCTCGAGATGAACCGAATCGGGCCTTGTACCGGTTCATCTTCGCCTCTGACGCCAACGGCTCTGAGCTGCTCACG
AGGACGTTTGCCATGGCCATATCACCAATACTCGATAAGCCCGACCAGCCGCACCGGCTGACGGCGTTCCCCTCG
CGCATCGAGCAGCGTAAGCCGTTCCTAATGCAGGGCCTCCTCGTGGGCGAGATCCTCGCATCACTGGCGCCCGGC
GCCGAGTCCGGCATCGCACGGAGCTGGCTGGCGTCGGGCAGCGGCCTCGCTCAGAATCTGTACCGCATCATCCAG
GAGCTCAGCGTTATGTACGAGCGGCCGCAGGTGGTGAATCGGCCTCCCGGTCGGATGCACTCGCCTCGAGATCCG
GAATTGGTATATATCGTCGTCGTCACGGTCGCCCTCCTCAAGAGGCTAATTGACAAGGCCGGCGACCCTAACCAG
CCTGGTGAGATCCCTGGCGACTTATTGCCGCAGCAGCAGCTTCTCGTCAACGCGTTGACGATGCAGTCGCCCGAC
TGGACAAAGGAGGGCATGCTCCTGCAACTGACGTCCATATTCAAGCATTGCCAGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail