Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05216
Gene name
Locationscaffold_05:2795077..2798379
Strand-
Gene length (bp)3302
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 2.3E-36 20 227

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 79 101 22
3 108 130 22
4 140 159 19
5 172 189 17
6 204 226 22
7 278 300 22
8 310 332 22
9 358 375 17
10 390 407 17
11 420 440 20
12 455 477 22
13 497 519 22
14 544 566 22
15 579 601 22
16 611 629 18
17 650 667 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.38 30.94 79.81
Alive In ants, during behavior modification 65.29 35.56 95.01
Dead In ants, recently dead 77.39 41.58 113.20

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.444856 no
Alive Dead 0.360034 no
Dead Fungus 0.094549 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05216
MATTRYKDKDAGVVVSFGGQWVSWAHTVAASTAFLSALLVGIALHYHKIVQNEFYGYPDEWFPSVSAAIGDRYPE
RSCFMIFIAVTSGPRFALVGLWYLLTRKQGSRLPGFVASMGVVRTLTCGGWTYVTSTDDHDWHDIFMISYIVATL
PWTTGCIALSPPNPQAIKYRKYIASTFFGTLVPLIYFFIRHKVHRVAGAYTIYAFLEWSLIILDVAFDAVTALDF
STFEVLVKDVKGSTKGEAASSLHSAVLEKEKQQATAGVYSGSFTWSEALDIAASVYHGFIFWSMLTSLGLLVWFF
PLWHMGISGYEAFVLVSASPALLVGPIRSLVVNNVRIVHLLSLVGVAAYLVPDQANRLLTVGVGVALSTLGWVAT
LHSESAHERRFESRLLGLMIGLILSSTAKFAWQTNNPVWPILHDANGGWNGTGLILGVLAALRFTRHAPLTGHLS
LGGKQGGSTVLAACGIGGLFFGLHSLLSDTSTMILWGWEGYPIRGPYFSTHGWCTVAAMSAGLGAGIWRPAVAGS
WTQYAAGAVGAMVLTKFSHWLGYLGGLGLAVYLMAVSVPLLSSACKKKPAVTFGLGFFIYVFMVLFHVWVVAYAF
VPGGPLVRERTDWIMMTMMMLIGAGVADYKASQPRRPQPRSPQTSQHRKFHGVATLLVNILFLCAAFKRFPRADH
KPYHGEDRILTAGIWTVHFSLDNDMWSSEYRMRDLIKEMELDVVGLLESDLQRIIMGNRDTTQFLAEDLGMYVDY
GPGPNKHTWGAALLSKFPIVESKHHLLPSPVGELAPAIHATLDVYGELVDVFVFHSGQEEDPEDRRLQSEYLSKL
MGSSPRPSILLSYLVTKPLEGNYKTYVSEQSGMHDIDWTDWDRWCEYILYKGLRRVGYARVSRSTITDTELQVGK
FVVPRSAAEMTQLEARPAEERDRRVKESEVPEGWRFPALFRGVGVRDHRYHVFDEPRYFN*
Coding >Ophcf2|05216
ATGGCGACGACACGATATAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTTGGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGACTGCCTTCTTGAGTGCCCTGTTGGTGGGCATCGCTCTACACTACCACAAAATCGTC
CAAAACGAATTCTACGGCTACCCAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAG
CGGTCATGCTTCATGATCTTTATCGCCGTCACATCTGGTCCACGCTTCGCCCTCGTCGGCTTGTGGTATCTCTTG
ACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCGATGGGTGTTGTTCGTACATTGACCTGCGGCGGT
TGGACTTACGTTACGTCGACCGATGACCACGACTGGCACGATATCTTCATGATCTCCTACATTGTCGCCACGCTG
CCTTGGACCACCGGTTGCATCGCCTTGAGCCCCCCGAACCCGCAAGCCATCAAGTATCGCAAATACATTGCCAGC
ACCTTTTTCGGAACCCTCGTCCCGCTCATCTACTTCTTCATCCGGCACAAAGTCCATCGCGTGGCTGGGGCTTAC
ACCATCTACGCCTTCCTCGAGTGGTCGCTCATCATCCTCGATGTGGCCTTTGACGCCGTCACAGCTCTCGACTTT
AGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGATCGACAAAGGGTGAAGCTGCTTCTTCATTGCACTCGGCA
GTGTTGGAGAAGGAAAAGCAACAAGCGACGGCGGGCGTTTACTCGGGCAGTTTCACGTGGTCCGAGGCCTTGGAC
ATTGCCGCGAGTGTCTATCATGGGTTCATCTTCTGGTCAATGCTGACCAGTCTGGGCCTTCTTGTCTGGTTCTTT
CCCCTCTGGCACATGGGTATATCCGGCTACGAGGCCTTCGTACTGGTCTCCGCATCGCCGGCACTCCTGGTCGGT
CCCATCCGATCATTGGTGGTCAATAACGTTCGGATTGTTCACCTGCTTTCGCTCGTCGGCGTCGCCGCATATCTC
GTTCCCGACCAAGCCAACCGTCTGCTGACCGTGGGAGTTGGTGTCGCCCTATCGACCTTGGGCTGGGTTGCCACA
CTACACTCAGAATCCGCACACGAGAGACGGTTTGAGTCGCGGCTGCTGGGGTTGATGATCGGCTTAATCCTTTCG
TCGACTGCCAAGTTTGCCTGGCAGACAAATAACCCCGTGTGGCCCATCTTGCACGACGCCAACGGAGGCTGGAAC
GGAACGGGCCTCATCCTCGGTGTCCTGGCAGCGTTGCGCTTCACTCGTCACGCGCCCCTGACCGGCCATCTCTCC
CTCGGGGGCAAGCAGGGGGGTTCGACCGTGCTCGCCGCCTGCGGCATCGGCGGGCTCTTCTTTGGACTTCACTCG
TTGCTGTCCGACACGAGCACCATGATCCTCTGGGGCTGGGAAGGATACCCCATCCGCGGCCCTTACTTCTCCACA
CACGGATGGTGCACGGTGGCGGCCATGTCGGCCGGTCTCGGGGCTGGCATCTGGAGGCCCGCAGTGGCCGGCAGC
TGGACGCAATACGCAGCGGGCGCGGTGGGAGCCATGGTTCTGACCAAGTTTAGCCACTGGCTCGGGTACTTGGGC
GGCCTAGGTCTGGCCGTGTACCTGATGGCCGTCTCGGTTCCCTTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCG
GTGACGTTTGGGCTGGGGTTCTTCATCTACGTCTTCATGGTGCTCTTCCATGTCTGGGTCGTGGCTTATGCCTTT
GTGCCCGGCGGGCCGCTCGTGCGCGAGCGTACGGACTGGATCATGATGACGATGATGATGCTCATCGGCGCCGGC
GTGGCCGACTATAAGGCCTCACAGCCGCGACGTCCCCAGCCACGGAGCCCCCAGACGTCACAGCATCGCAAGTTT
CACGGGGTGGCGACGCTGTTGGTCAACATTCTCTTCCTCTGTGCCGCCTTTAAACGGTTCCCCAGGGCGGACCAC
AAGCCGTACCACGGCGAGGACCGCATCTTGACGGCCGGCATCTGGACGGTGCACTTCTCGCTCGACAATGACATG
TGGTCGTCGGAATATCGGATGCGCGACCTGATAAAGGAGATGGAGCTGGACGTGGTTGGCCTTCTCGAGTCGGAT
CTGCAGCGCATCATCATGGGCAACCGTGACACGACGCAGTTCCTGGCCGAGGATCTCGGCATGTACGTCGACTAC
GGGCCCGGGCCCAACAAGCACACTTGGGGCGCGGCGCTGCTGTCCAAGTTCCCGATCGTCGAGTCCAAGCACCAC
CTGCTGCCGAGCCCGGTAGGGGAGCTGGCGCCGGCGATACACGCGACGCTGGACGTCTACGGCGAGCTGGTCGAC
GTCTTCGTCTTCCACTCAGGCCAGGAGGAGGATCCGGAGGACCGGAGGCTGCAGAGCGAGTATCTGAGCAAGCTG
ATGGGCTCGAGCCCGAGGCCGTCGATCCTACTGAGCTACCTGGTGACGAAGCCGCTCGAGGGCAATTACAAGACG
TACGTCAGCGAACAGTCGGGCATGCACGATATCGACTGGACCGACTGGGATCGATGGTGCGAGTACATCCTGTAC
AAGGGTCTCCGGCGTGTGGGCTATGCTCGTGTCAGCCGCAGTACCATAACCGACACGGAGCTGCAGGTGGGCAAG
TTTGTCGTCCCCCGCTCGGCCGCGGAGATGACGCAGCTGGAGGCGCGGCCAGCCGAGGAACGGGACCGGCGAGTG
AAGGAGTCGGAGGTACCGGAAGGGTGGAGGTTCCCGGCGCTGTTCCGGGGAGTCGGCGTGCGGGATCACCGGTAT
CATGTCTTTGATGAGCCGAGGTATTTCAACTAG
Transcript >Ophcf2|05216
ATGGCGACGACACGATATAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTTGGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGACTGCCTTCTTGAGTGCCCTGTTGGTGGGCATCGCTCTACACTACCACAAAATCGTC
CAAAACGAATTCTACGGCTACCCAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAG
CGGTCATGCTTCATGATCTTTATCGCCGTCACATCTGGTCCACGCTTCGCCCTCGTCGGCTTGTGGTATCTCTTG
ACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCGATGGGTGTTGTTCGTACATTGACCTGCGGCGGT
TGGACTTACGTTACGTCGACCGATGACCACGACTGGCACGATATCTTCATGATCTCCTACATTGTCGCCACGCTG
CCTTGGACCACCGGTTGCATCGCCTTGAGCCCCCCGAACCCGCAAGCCATCAAGTATCGCAAATACATTGCCAGC
ACCTTTTTCGGAACCCTCGTCCCGCTCATCTACTTCTTCATCCGGCACAAAGTCCATCGCGTGGCTGGGGCTTAC
ACCATCTACGCCTTCCTCGAGTGGTCGCTCATCATCCTCGATGTGGCCTTTGACGCCGTCACAGCTCTCGACTTT
AGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGATCGACAAAGGGTGAAGCTGCTTCTTCATTGCACTCGGCA
GTGTTGGAGAAGGAAAAGCAACAAGCGACGGCGGGCGTTTACTCGGGCAGTTTCACGTGGTCCGAGGCCTTGGAC
ATTGCCGCGAGTGTCTATCATGGGTTCATCTTCTGGTCAATGCTGACCAGTCTGGGCCTTCTTGTCTGGTTCTTT
CCCCTCTGGCACATGGGTATATCCGGCTACGAGGCCTTCGTACTGGTCTCCGCATCGCCGGCACTCCTGGTCGGT
CCCATCCGATCATTGGTGGTCAATAACGTTCGGATTGTTCACCTGCTTTCGCTCGTCGGCGTCGCCGCATATCTC
GTTCCCGACCAAGCCAACCGTCTGCTGACCGTGGGAGTTGGTGTCGCCCTATCGACCTTGGGCTGGGTTGCCACA
CTACACTCAGAATCCGCACACGAGAGACGGTTTGAGTCGCGGCTGCTGGGGTTGATGATCGGCTTAATCCTTTCG
TCGACTGCCAAGTTTGCCTGGCAGACAAATAACCCCGTGTGGCCCATCTTGCACGACGCCAACGGAGGCTGGAAC
GGAACGGGCCTCATCCTCGGTGTCCTGGCAGCGTTGCGCTTCACTCGTCACGCGCCCCTGACCGGCCATCTCTCC
CTCGGGGGCAAGCAGGGGGGTTCGACCGTGCTCGCCGCCTGCGGCATCGGCGGGCTCTTCTTTGGACTTCACTCG
TTGCTGTCCGACACGAGCACCATGATCCTCTGGGGCTGGGAAGGATACCCCATCCGCGGCCCTTACTTCTCCACA
CACGGATGGTGCACGGTGGCGGCCATGTCGGCCGGTCTCGGGGCTGGCATCTGGAGGCCCGCAGTGGCCGGCAGC
TGGACGCAATACGCAGCGGGCGCGGTGGGAGCCATGGTTCTGACCAAGTTTAGCCACTGGCTCGGGTACTTGGGC
GGCCTAGGTCTGGCCGTGTACCTGATGGCCGTCTCGGTTCCCTTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCG
GTGACGTTTGGGCTGGGGTTCTTCATCTACGTCTTCATGGTGCTCTTCCATGTCTGGGTCGTGGCTTATGCCTTT
GTGCCCGGCGGGCCGCTCGTGCGCGAGCGTACGGACTGGATCATGATGACGATGATGATGCTCATCGGCGCCGGC
GTGGCCGACTATAAGGCCTCACAGCCGCGACGTCCCCAGCCACGGAGCCCCCAGACGTCACAGCATCGCAAGTTT
CACGGGGTGGCGACGCTGTTGGTCAACATTCTCTTCCTCTGTGCCGCCTTTAAACGGTTCCCCAGGGCGGACCAC
AAGCCGTACCACGGCGAGGACCGCATCTTGACGGCCGGCATCTGGACGGTGCACTTCTCGCTCGACAATGACATG
TGGTCGTCGGAATATCGGATGCGCGACCTGATAAAGGAGATGGAGCTGGACGTGGTTGGCCTTCTCGAGTCGGAT
CTGCAGCGCATCATCATGGGCAACCGTGACACGACGCAGTTCCTGGCCGAGGATCTCGGCATGTACGTCGACTAC
GGGCCCGGGCCCAACAAGCACACTTGGGGCGCGGCGCTGCTGTCCAAGTTCCCGATCGTCGAGTCCAAGCACCAC
CTGCTGCCGAGCCCGGTAGGGGAGCTGGCGCCGGCGATACACGCGACGCTGGACGTCTACGGCGAGCTGGTCGAC
GTCTTCGTCTTCCACTCAGGCCAGGAGGAGGATCCGGAGGACCGGAGGCTGCAGAGCGAGTATCTGAGCAAGCTG
ATGGGCTCGAGCCCGAGGCCGTCGATCCTACTGAGCTACCTGGTGACGAAGCCGCTCGAGGGCAATTACAAGACG
TACGTCAGCGAACAGTCGGGCATGCACGATATCGACTGGACCGACTGGGATCGATGGTGCGAGTACATCCTGTAC
AAGGGTCTCCGGCGTGTGGGCTATGCTCGTGTCAGCCGCAGTACCATAACCGACACGGAGCTGCAGGTGGGCAAG
TTTGTCGTCCCCCGCTCGGCCGCGGAGATGACGCAGCTGGAGGCGCGGCCAGCCGAGGAACGGGACCGGCGAGTG
AAGGAGTCGGAGGTACCGGAAGGGTGGAGGTTCCCGGCGCTGTTCCGGGGAGTCGGCGTGCGGGATCACCGGTAT
CATGTCTTTGATGAGCCGAGGTATTTCAACTAG
Gene >Ophcf2|05216
ATGGCGACGACACGATATAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTTGGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGAGTGAGTCCTGGTCGCCGTATGCGACGAGTTTGATCCTGATCGATTGTGTTCAGCTG
CCTTCTTGAGTGCCCTGTTGGTGGGCATCGCTCTACACTACCACAAAATCGTCCAAAACGAATTCTACGGCTACC
CAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAGCGGTCATGCTTCATGATCTTTA
TCGCCGTCACATCTGGTACGCTCTCTCGTCTACCTACACACCCGCTGCCGGGTCTGACCCGTCCCAGGTCCACGC
TTCGCCCTCGTCGGCTTGTGGTATCTCTTGACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCGATG
GGTGTTGTTCGTACATTGACCTGCGGCGGTTGGACTTACGTTACGTCGACCGATGACCACGACTGGCACGATATC
TTCATGATCTCCTACATTGTCGCCACGCTGCCTTGGACCACCGGTTGCATCGCCTTGAGCCCCCCGAACCCGCAA
GCCATCAAGTATCGCAAATACATTGCCAGCACCTTTTTCGGAACCCTCGTCCCGCTCATCTACTTCTTCATCCGG
CACAAAGTCCATCGCGTGGCTGGGGGTATGTCGCGTCTCTCAGACAGTGGTCAACGCAACACTGACAAGCATAGC
TTACACCATCTACGCCTTCCTCGAGTGGTCGCTCATCATCCTCGATGTGGCCTTTGACGCCGTCACAGCTCTCGA
CTTTAGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGATCGACAAAGGGGTACGTCCAATGGCTACCGAGATA
GCGCTCGCTTCTTGTACAGTCACCCCCAATACAATGTTTCCCCGCCCATCGTATCTAAAGCGCCCCTCTCTCTGC
AGTGAAGCTGCTTCTTCATTGCACTCGGCAGTGTTGGAGAAGGAGTGAGTTCGACCGCGCGCCGAGGGATGACGC
ACCACTGACGAGACCCTTAGAAAGCAACAAGCGACGGCGGGCGTTTACTCGGGCAGTTTCACGTGGTCCGAGGCC
TTGGACATTGCCGCGAGTGTCTATCATGGGGTAAGGCAGAGCTCTCCGCTCTCACGGCAGGAGTCTGTCTGGTTA
CTGACTCTAGACAGTTCATCTTCTGGTCAATGCTGACCAGTCTGGGCCTTCTTGTCTGGTGTGAGTTTTTCCGAC
GTCTATACTTTCTCTGCCCAGGCTTATGAGTTTCCCAAGTCTTTCCCCTCTGGCACATGGGTATATCCGGCTACG
AGGCCTTCGTACTGGTCTCCGCATCGCCGGCACTCCTGGTCGGTCCCATCCGATCATTGGTGGTCAATAACGTTC
GGATTGTTCACCTGCTTTCGCTCGTCGGCGTCGCCGCATATCTCGTTCCCGACCAAGCCAACCGTCTGCTGACCG
TGGGAGTTGGTGTCGCCCTATCGACCTTGGGCTGGGTTGCCACACTACACTCAGAATCCGCACACGAGAGACGGT
TTGAGTCGCGGCTGCTGGGGTTGATGATCGGCTTAATCCTTTCGTCGACTGCCAAGTTTGCCTGGCAGACAAATA
ACCCCGTGTGGCCCATCTTGCACGACGCCAACGGAGGCTGGAACGGAACGGGCCTCATCCTCGGTGTCCTGGCAG
CGTTGCGCTTCACTCGTCACGCGCCCCTGACCGGCCATCTCTCCCTCGGGGGCAAGCAGGGGGGTTCGACCGTGC
TCGCCGCCTGCGGCATCGGCGGGCTCTTCTTTGGACTTCACTCGTTGCTGTCCGACACGAGCACCATGATCCTCT
GGGGCTGGGAAGGATACCCCATCCGCGGCCCTTACTTCTCCACACACGGATGGTGCACGGTGGCGGCCATGTCGG
CCGGTCTCGGGGCTGGCATCTGGAGGCCCGCAGTGGCCGGCAGCTGGACGCAATACGCAGCGGGCGCGGTGGGAG
CCATGGTTCTGACCAAGTTTAGCCACTGGCTCGGGTACTTGGGCGGCCTAGGTCTGGCCGTGTACCTGATGGCCG
TCTCGGTTCCCTTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCGGTGACGTTTGGGCTGGGGTTCTTCATCTACG
TCTTCATGGTGCTCTTCCATGTCTGGGTCGTGGCTTATGCCTTTGTGCCCGGCGGGCCGCTCGTGCGCGAGCGTA
CGGACTGGATCATGATGACGATGATGATGCTCATCGGCGCCGGCGTGGCCGACTATAAGGCCTCACAGCCGCGAC
GTCCCCAGCCACGGAGCCCCCAGACGTCACAGCATCGCAAGTTTCACGGGGTGGCGACGCTGTTGGTCAACATTC
TCTTCCTCTGTGCCGCCTTTAAACGGTTCCCCAGGGCGGACCACAAGCCGTACCACGGCGAGGACCGCATCTTGA
CGGCCGGCATCTGGACGGTGCACTTCTCGCTCGACAATGACATGTGGTCGTCGGAATATCGGATGCGCGACCTGA
TAAAGGAGATGGAGCTGGACGTGGTTGGCCTTCTCGAGTCGGATCTGCAGCGCATCATCATGGGCAACCGTGACA
CGACGCAGTTCCTGGCCGAGGATCTCGGCATGTACGTCGACTACGGGCCCGGGCCCAACAAGCACACTTGGGGCG
CGGCGCTGCTGTCCAAGTTCCCGATCGTCGAGTCCAAGCACCACCTGCTGCCGAGCCCGGTAGGGGAGCTGGCGC
CGGCGATACACGCGACGCTGGACGTCTACGGCGAGCTGGTCGACGTCTTCGTCTTCCACTCAGGCCAGGAGGAGG
ATCCGGAGGACCGGAGGCTGCAGAGCGAGTATCTGAGCAAGCTGATGGGCTCGAGCCCGAGGCCGTCGATCCTAC
TGAGCTACCTGGTGACGAAGCCGCTCGAGGGCAATTACAAGACGTACGTCAGCGAACAGTCGGGCATGCACGATA
TCGACTGGACCGACTGGGATCGATGGTGCGAGTACATCCTGTACAAGGGTCTCCGGCGTGTGGGCTATGCTCGTG
TCAGCCGCAGTACCATAACCGACACGGAGCTGCAGGTGGGCAAGTTTGTCGTCCCCCGCTCGGCCGCGGAGATGA
CGCAGCTGGAGGCGCGGCCAGCCGAGGAACGGGACCGGCGAGTGAAGGAGTCGGAGGTACCGGAAGGGTGGAGGT
TCCCGGCGCTGTTCCGGGGAGTCGGCGTGCGGGATCACCGGTATCATGTCTTTGATGAGCCGAGGTATTTCAACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail