Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05211
Gene name
Locationscaffold_05:2779941..2786718
Strand+
Gene length (bp)6777
Transcript length (bp)6513
Coding sequence length (bp)6513
Protein length (aa) 2171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08490 DUF1744 Domain of unknown function (DUF1744) 5.8E-126 1526 1901
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 6.5E-72 97 436
PF00136 DNA_pol_B DNA polymerase family B 2.1E-11 789 1150
PF10108 DNA_pol_B_exo2 Predicted 3'-5' exonuclease related to the exonuclease domain of PolB 1.8E-08 346 484

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0008270 zinc ion binding Yes
GO:0005634 nucleus Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0008152 metabolic process No
GO:0006259 DNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0140097 catalytic activity, acting on DNA No
GO:0016779 nucleotidyltransferase activity No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0090304 nucleic acid metabolic process No
GO:0034061 DNA polymerase activity No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3994 0.7529 0.1559 0.0646 0.1335 0.0601 0.0655 0.0582 0.0635 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4864
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5335
Ophiocordyceps australis map64 (Brazil) OphauB2|6603
Ophiocordyceps camponoti-floridani Ophcf2|05211 (this protein)
Ophiocordyceps kimflemingae Ophio5|4721
Ophiocordyceps subramaniannii Hirsu2|11038

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05211
MPNTSLRRPQKGFRRGGKTAYHGGRKTFTASSRAEGTSIAEKWEKTQLANSIDENMGFARYESGKRRDGWLVSVQ
STSIHDERIPGGRAALDCYFIEAEGDTFKATVEYDPYFLIAVRRGREADVEEWAKRVPGGGVVKTIRRVEKDDLK
MPNHLLGHRRTFLELRFANVGDLMAARKDIIPVAEKNKKNMDAIDTYAEVVMASGDVDLFDDDDMRDDGKTFKEA
SDFIIDIREYDVPYHVRVMIDLDIRVGKWYFVEAKHGTTRIWANEERSLPADPTVLAFDIETTKLPLKFPDATVD
QIMMISYMIDGQGFLVTNRDIISEDIGDFEYTPKPEYPGAFIIFNEPNEKAVIERFFLHVKEARPTVIATYNGDF
FDWPFVEARASINGIDMYQEIGWKKDGDDQFKCNYGVHMDCFHWVNRDSYLPQGSRGLKAVTVAKLGYDPDELDP
ELMTPYARERPQTLAEYSVSDAVATYYLYMKYVHPFIFSLCTILPLGGDDTLRKGTGTLCEMLLMVQAYKKEIVL
PNKHQSPREAFWDGHLLDSETYVGGHVESIEAGVFRADIPVDFSVEPAAIDELLRDLDAALEFVVTVEEKKSMDD
VENYDEVRRQMAQKLTELKERPKRHEKPLIYHLDVASMYPNIMTTNRLQPDSMISESDCAACDFNRPGKTCDRRM
PWAWRGEYLPAKRDEYNMIRNALQGEKFPGKTAQAPARTFAQLSPDEQAGLVRKRLQLYSQKVYHKIHDSTTIVR
EAIICQRENPFYINTVRDFRDRRYDYKGKAKVWKGKTDELKSAGATAVDVEAAKKMVIVYDSLQLAHKVILNSFY
GYVMRKGSRWYSMEMAGVTCLTGAHIIQMARQLVERLGRPLELDTDGIWCMLPASFPENFTLRLKNGKKMGISYP
CVMLNHLVHARFTNDQYQTLVDGRTFRYETHSDNSIFFEVDGPYRAMVLPTSKEEDKNLKKRYAVFNHDGSLAEL
KGFEVKRRGELKLIKIFQQQIFRFFLEGRDLAECYSAVAQVANRWLDVLDNKGTTLADEELMDLISENRSMSKTL
EEYGGQKSTSITTARRLADFLGDQMVKDKGLNCKFIICSKPRNAPVTQRAVPVAIFSADETVKRTYLRKWLKEDP
SDTDPRALLDWSYYAERLGSVIQKLITIPAALQKVRNPVPRVPHPEWLQRRIRIKDDKMKQMKLTDGLLSKLEND
MEDFGAVAKQLLGPKPVGEAVASSMMRETEEKNKMMMMMMKKKKKKRKSPDEAADDENEPPLPSKAPSPSENYSA
FLAYEKRKWKMQKQARVRRRQLFGERRSTNMQGNNNIQQTFRKQAHDTFMRPWQLLQLKDTDSPGTVAAYVLIDG
KMHHLKIRVNRQVYLNLKSERLPDVDIAGCEVEQVQHTLPNGHASTYLFRLTVGEDIYVAEADRFDQLFRHPSVE
GVYETQVPLSVRAVLRLGNVCTVDDQRQGVLGRGLETGFELDGLKRPQKTAYLESWPLAYVFVSHMTAGERQVFG
LFSSSGDEAHVVIVGGGGQDVMMPNMSNLYDDMLAARRSEADSNWQDCFRYQERLRFRTKQVTTRRKAQLEVADV
VRRMRRDETGPLLAVVRSPHREQLVVDVPVLAHLPLLTLPYDSADGAWPPLGWQTTAARRLVAQYLGLGSWVAHL
TALARYGDVPLCNLDRDDARFLIDVAYARRLQANGVVLWWSPGPRPDHGGHERDAVPTAATRLGAVNSAGSSAGT
VCLDVEVRNLAVNTMLTSSLINELEGAASDHDVLVSDKAFSRAAVVVLGDMVKAWWAEACRGGTMADILVQHLVR
WVESRRSFLFDEALHQHVLMMSRKALQQLMADFRRLGCQIIFTSADRIMLRTTKAEVGTAFAFGEYMVKSIKARP
LFHFIDLEIRGYWDYLVWYDEHNYGGRVCRQRVLETDEVQQQLETVMHWQMATFLPRLLQPVFEELTTAFVERMH
RLKRGAFNELDDEEEEEEEEAVEAGDAGSTPPRPTQLPKKKGADDEDEKRIVLGKPLMKTIEKTLASVTARQRRE
LLHPELASDYGFPKDLPGRHLTPTNPSLELSKTILQVLSLERSATPETRRLRRDVLSRLFSINDFSREASFANPS
SSLRLEQVSCDNCTLARDLDLCRDEALLAGRPWRCPLCGVPYDEVALEERVLGLAWGGVAEWAVMDVVSF*
Coding >Ophcf2|05211
ATGCCCAACACAAGTCTCCGTCGCCCGCAAAAGGGGTTCCGCCGCGGCGGCAAGACGGCCTACCATGGCGGCCGG
AAGACGTTTACCGCCTCGTCCCGGGCCGAAGGCACCTCGATCGCCGAAAAGTGGGAGAAAACTCAGCTGGCAAAC
TCCATCGACGAGAACATGGGCTTCGCCCGTTACGAGAGCGGCAAGCGCAGGGACGGCTGGCTCGTCAGTGTGCAG
TCGACTTCGATCCACGATGAGCGCATACCAGGAGGTCGAGCCGCGCTCGACTGCTACTTCATCGAGGCCGAGGGA
GACACCTTCAAGGCCACGGTTGAATACGACCCCTACTTCCTCATCGCCGTCAGGAGAGGCCGCGAGGCCGACGTC
GAGGAATGGGCCAAGCGCGTTCCCGGTGGCGGCGTCGTCAAGACGATCCGCAGGGTCGAAAAAGACGACTTGAAG
ATGCCAAATCATCTACTGGGCCACCGACGGACCTTTCTAGAGCTCCGGTTCGCTAACGTCGGCGATCTGATGGCG
GCCAGAAAAGACATCATCCCGGTGGCGGAAAAGAACAAGAAGAATATGGATGCCATCGATACGTATGCCGAGGTT
GTCATGGCCAGTGGCGACGTGGACTTGTTCGACGACGACGACATGCGCGACGATGGCAAGACGTTCAAGGAAGCC
AGCGACTTCATCATCGACATCCGCGAGTACGATGTGCCCTACCATGTGAGGGTCATGATCGATCTCGATATACGA
GTGGGCAAGTGGTATTTTGTCGAGGCCAAACACGGCACCACCAGGATCTGGGCAAACGAAGAGCGTTCTTTACCC
GCGGACCCTACCGTACTGGCGTTCGATATAGAGACGACGAAGCTACCACTCAAATTCCCCGACGCCACTGTGGAC
CAGATCATGATGATCTCGTACATGATTGACGGCCAGGGCTTCCTCGTCACCAACCGCGACATCATCTCGGAAGAC
ATTGGCGACTTTGAGTACACGCCCAAGCCCGAGTATCCGGGGGCCTTTATCATCTTCAACGAGCCCAACGAAAAG
GCCGTCATCGAACGCTTCTTCCTTCACGTCAAGGAGGCGCGGCCGACGGTCATCGCCACATACAACGGCGACTTC
TTCGACTGGCCCTTTGTCGAGGCCCGTGCTAGTATCAACGGTATCGACATGTACCAGGAGATTGGGTGGAAGAAA
GACGGCGACGACCAGTTCAAGTGCAACTACGGCGTCCACATGGACTGCTTCCACTGGGTCAACCGAGACTCGTAT
CTGCCCCAGGGGTCTCGCGGCCTCAAAGCCGTGACGGTGGCCAAGCTCGGCTACGACCCGGACGAGCTGGACCCG
GAGCTGATGACGCCGTACGCCAGGGAGCGGCCTCAGACGCTGGCCGAGTACTCTGTGTCGGACGCGGTGGCGACG
TACTACCTCTACATGAAATACGTCCATCCCTTCATCTTCTCGCTCTGCACCATCCTACCGCTCGGAGGCGACGAT
ACGCTGCGCAAGGGAACTGGCACGCTGTGCGAGATGCTGCTGATGGTGCAGGCCTATAAGAAGGAGATTGTGCTA
CCGAACAAGCACCAGTCGCCGCGCGAGGCCTTTTGGGACGGCCACCTACTCGACTCGGAGACGTACGTGGGCGGC
CACGTCGAGAGTATCGAGGCCGGTGTCTTCCGGGCCGATATCCCCGTCGACTTCTCCGTCGAGCCGGCCGCCATC
GACGAGCTGCTGCGGGACCTGGACGCCGCACTCGAGTTTGTCGTGACGGTGGAGGAGAAGAAGTCGATGGACGAC
GTGGAAAACTACGACGAGGTGCGGCGGCAGATGGCCCAGAAACTGACGGAACTGAAGGAGAGGCCCAAGAGGCAC
GAGAAGCCGCTCATCTACCACTTGGACGTGGCCTCCATGTATCCCAACATCATGACGACCAACCGCTTGCAGCCG
GACTCGATGATCTCCGAATCCGACTGTGCTGCATGTGACTTCAACCGGCCTGGCAAGACGTGCGATCGACGAATG
CCTTGGGCCTGGAGAGGCGAGTATCTGCCGGCCAAGCGGGACGAGTACAATATGATCCGCAACGCGCTCCAGGGG
GAGAAGTTTCCGGGAAAGACGGCCCAGGCACCGGCTCGGACCTTTGCCCAGCTGAGCCCTGATGAGCAGGCCGGG
CTCGTCCGCAAACGGCTGCAGCTCTACTCGCAAAAGGTGTATCACAAGATCCACGACTCGACCACCATAGTTCGC
GAGGCCATCATCTGCCAGCGCGAGAACCCCTTTTACATCAACACGGTACGCGACTTCCGTGACCGCCGCTACGAT
TACAAGGGCAAGGCCAAGGTGTGGAAGGGCAAGACGGACGAGCTCAAGTCTGCGGGCGCGACGGCGGTCGATGTC
GAGGCGGCCAAGAAGATGGTCATCGTCTACGACTCGCTGCAGTTGGCTCACAAGGTCATCCTCAACTCCTTCTAC
GGCTACGTCATGCGCAAGGGCTCGCGCTGGTACTCGATGGAGATGGCTGGCGTCACCTGCTTGACGGGCGCCCAC
ATCATCCAGATGGCCAGGCAGCTGGTCGAGCGGCTGGGAAGACCGCTCGAGCTCGACACGGACGGTATCTGGTGC
ATGCTGCCGGCCAGCTTCCCGGAGAACTTTACGCTGAGGCTGAAGAATGGTAAGAAGATGGGCATCTCTTATCCC
TGCGTCATGCTCAACCATCTGGTGCACGCCCGCTTCACAAACGACCAGTACCAGACGCTGGTCGACGGCCGGACG
TTCCGGTACGAGACGCACAGCGACAACTCCATCTTCTTCGAAGTCGACGGGCCGTACCGGGCCATGGTACTGCCC
ACGTCCAAGGAGGAGGACAAGAACCTCAAGAAGCGCTACGCCGTCTTCAACCACGACGGCAGCCTGGCCGAGCTC
AAGGGCTTCGAGGTGAAACGGCGAGGCGAGCTCAAGCTCATCAAGATCTTCCAGCAGCAAATCTTCCGCTTCTTC
CTCGAAGGCCGCGATCTGGCCGAGTGCTACAGCGCCGTGGCTCAGGTGGCCAACCGCTGGCTGGACGTGCTCGAC
AACAAGGGCACGACGCTGGCCGACGAGGAGCTGATGGACCTCATCTCGGAGAACCGGAGCATGTCCAAGACGCTG
GAAGAGTACGGAGGACAAAAGTCGACGAGCATCACCACGGCCCGCCGGCTGGCCGACTTTCTAGGCGACCAGATG
GTCAAAGACAAGGGGCTCAACTGCAAGTTCATCATCTGTTCCAAGCCTCGCAACGCACCCGTGACCCAGCGGGCC
GTTCCCGTCGCCATCTTCTCCGCCGACGAGACCGTCAAGCGGACCTACCTCCGCAAGTGGCTCAAGGAGGACCCG
TCCGACACGGACCCGAGGGCGCTGCTGGACTGGTCCTACTACGCCGAACGGCTGGGGTCTGTCATCCAGAAGCTC
ATCACGATCCCCGCGGCGCTGCAAAAGGTCAGGAATCCGGTGCCGCGGGTGCCGCATCCGGAGTGGCTTCAGCGG
AGGATCAGGATCAAGGACGACAAGATGAAGCAGATGAAGCTGACGGACGGTCTGCTGAGCAAGCTCGAGAACGAC
ATGGAGGACTTTGGGGCGGTGGCCAAGCAGCTTCTGGGGCCCAAGCCGGTGGGCGAGGCTGTGGCATCGTCCATG
ATGCGTGAGACGGAGGAGAAGAACAAGATGATGATGATGATGATGAAGAAGAAGAAGAAGAAGCGCAAGTCACCC
GACGAAGCGGCGGATGACGAGAACGAACCCCCCCTGCCAAGCAAAGCGCCTAGCCCATCGGAGAACTACTCGGCC
TTTCTGGCGTACGAAAAGAGGAAGTGGAAGATGCAGAAGCAGGCTCGCGTCCGCAGGAGGCAGCTCTTTGGCGAG
AGGAGAAGCACCAATATGCAAGGCAATAACAACATCCAGCAGACGTTCCGGAAGCAGGCCCACGATACCTTTATG
AGGCCCTGGCAGCTGCTGCAGCTCAAAGACACGGACAGTCCCGGGACGGTGGCGGCATACGTGCTGATTGACGGC
AAGATGCACCACCTCAAGATACGGGTGAATCGGCAGGTCTACCTTAACCTCAAGAGCGAGCGTCTCCCGGACGTG
GACATTGCCGGATGTGAGGTGGAACAGGTGCAGCACACGCTTCCCAACGGACACGCGTCGACATACCTGTTCCGG
CTCACGGTAGGCGAGGACATCTACGTTGCCGAGGCGGACCGGTTCGATCAGCTCTTCCGGCACCCGAGCGTCGAG
GGCGTGTACGAGACACAGGTTCCGCTGAGCGTACGGGCGGTGCTGAGGTTGGGCAACGTTTGTACCGTCGACGAC
CAGCGGCAGGGCGTCCTGGGCAGGGGGCTGGAGACGGGCTTCGAGCTGGACGGGCTGAAGCGGCCTCAGAAGACG
GCCTACCTGGAGTCGTGGCCACTGGCGTACGTCTTCGTCTCGCACATGACGGCCGGCGAACGACAGGTGTTTGGC
CTGTTCTCGAGCTCCGGTGACGAGGCTCACGTCGTCATCGTCGGCGGTGGAGGCCAGGACGTGATGATGCCCAAC
ATGAGCAACCTGTACGACGACATGTTGGCAGCGAGGCGGTCAGAAGCGGACAGCAACTGGCAAGACTGCTTCCGC
TACCAGGAGAGACTTCGCTTCCGGACGAAACAGGTGACGACACGACGCAAGGCCCAGCTAGAGGTGGCCGATGTG
GTGCGAAGGATGCGTCGGGACGAGACCGGGCCGCTGCTGGCCGTCGTCCGGTCACCGCATCGGGAGCAACTGGTG
GTCGACGTCCCGGTGCTGGCCCATCTCCCGCTGCTGACGCTCCCCTACGACTCGGCAGACGGGGCGTGGCCTCCG
CTGGGCTGGCAGACGACGGCCGCCCGGAGGCTGGTTGCTCAGTATCTCGGGCTCGGATCGTGGGTGGCTCATCTC
ACGGCGCTGGCCCGGTACGGTGACGTTCCGCTATGCAACCTGGACCGTGACGACGCCCGATTCCTCATCGACGTG
GCCTACGCCCGTCGGCTACAGGCCAATGGCGTCGTTCTCTGGTGGTCTCCCGGCCCGCGTCCGGACCACGGCGGT
CACGAGCGGGATGCCGTGCCGACGGCAGCGACTCGGCTCGGGGCCGTCAACAGCGCCGGGTCTTCGGCCGGAACC
GTCTGTCTCGACGTCGAGGTCCGTAACCTGGCCGTCAACACGATGCTGACGTCTTCGCTCATCAACGAGCTCGAG
GGCGCCGCTTCGGATCACGACGTGCTCGTCTCAGACAAGGCCTTCTCGCGCGCTGCCGTCGTCGTTCTCGGCGAC
ATGGTCAAGGCTTGGTGGGCAGAAGCCTGCCGCGGCGGTACGATGGCCGACATCCTCGTCCAGCACCTGGTCCGT
TGGGTCGAGAGCAGACGCTCGTTCCTCTTCGACGAGGCTCTACACCAGCACGTCCTCATGATGTCTCGCAAGGCT
CTACAGCAGCTCATGGCCGACTTCCGCCGCCTCGGCTGCCAGATCATCTTCACCAGCGCCGACCGCATCATGCTG
CGAACTACAAAGGCAGAGGTCGGCACCGCCTTTGCCTTTGGCGAGTACATGGTCAAGTCGATCAAGGCCCGGCCT
CTCTTCCACTTCATCGACCTGGAGATCCGCGGCTACTGGGACTATCTTGTCTGGTACGACGAGCACAACTACGGC
GGCCGAGTCTGTCGCCAAAGAGTTCTAGAGACGGACGAGGTCCAACAGCAGCTGGAGACGGTCATGCACTGGCAG
ATGGCCACCTTTTTGCCCCGGCTCCTGCAGCCCGTGTTCGAGGAGCTGACGACGGCGTTTGTCGAGCGGATGCAT
CGTCTGAAGCGCGGTGCCTTTAACGAGCTCGATGATGAGGAGGAGGAGGAGGAGGAGGAGGCTGTCGAAGCGGGT
GATGCAGGTTCAACGCCACCGCGGCCTACGCAGCTTCCCAAGAAGAAGGGAGCCGATGACGAGGACGAAAAGCGC
ATCGTCCTCGGAAAGCCTCTGATGAAGACGATAGAAAAGACGCTCGCCAGCGTCACGGCCCGACAGAGACGAGAA
CTCCTCCATCCAGAGCTCGCCTCCGACTACGGATTCCCAAAGGACCTCCCCGGCCGACACCTCACGCCAACGAAC
CCGAGCCTGGAACTCTCCAAGACAATCCTCCAAGTCCTCTCGCTCGAACGCAGCGCCACGCCCGAGACACGTCGT
CTCCGCCGCGACGTCCTCTCCCGCCTCTTCTCCATCAACGACTTCTCCCGCGAAGCCTCCTTCGCGAACCCCTCC
TCGTCGCTTCGTCTGGAGCAGGTCTCGTGCGACAACTGCACGCTGGCGCGGGATCTGGACCTGTGTCGCGACGAG
GCCTTGCTGGCGGGTAGGCCGTGGCGATGTCCGCTCTGCGGCGTGCCGTACGACGAGGTCGCGTTGGAGGAGAGG
GTCTTGGGTTTGGCTTGGGGGGGCGTCGCCGAGTGGGCCGTCATGGATGTTGTTTCTTTTTGA
Transcript >Ophcf2|05211
ATGCCCAACACAAGTCTCCGTCGCCCGCAAAAGGGGTTCCGCCGCGGCGGCAAGACGGCCTACCATGGCGGCCGG
AAGACGTTTACCGCCTCGTCCCGGGCCGAAGGCACCTCGATCGCCGAAAAGTGGGAGAAAACTCAGCTGGCAAAC
TCCATCGACGAGAACATGGGCTTCGCCCGTTACGAGAGCGGCAAGCGCAGGGACGGCTGGCTCGTCAGTGTGCAG
TCGACTTCGATCCACGATGAGCGCATACCAGGAGGTCGAGCCGCGCTCGACTGCTACTTCATCGAGGCCGAGGGA
GACACCTTCAAGGCCACGGTTGAATACGACCCCTACTTCCTCATCGCCGTCAGGAGAGGCCGCGAGGCCGACGTC
GAGGAATGGGCCAAGCGCGTTCCCGGTGGCGGCGTCGTCAAGACGATCCGCAGGGTCGAAAAAGACGACTTGAAG
ATGCCAAATCATCTACTGGGCCACCGACGGACCTTTCTAGAGCTCCGGTTCGCTAACGTCGGCGATCTGATGGCG
GCCAGAAAAGACATCATCCCGGTGGCGGAAAAGAACAAGAAGAATATGGATGCCATCGATACGTATGCCGAGGTT
GTCATGGCCAGTGGCGACGTGGACTTGTTCGACGACGACGACATGCGCGACGATGGCAAGACGTTCAAGGAAGCC
AGCGACTTCATCATCGACATCCGCGAGTACGATGTGCCCTACCATGTGAGGGTCATGATCGATCTCGATATACGA
GTGGGCAAGTGGTATTTTGTCGAGGCCAAACACGGCACCACCAGGATCTGGGCAAACGAAGAGCGTTCTTTACCC
GCGGACCCTACCGTACTGGCGTTCGATATAGAGACGACGAAGCTACCACTCAAATTCCCCGACGCCACTGTGGAC
CAGATCATGATGATCTCGTACATGATTGACGGCCAGGGCTTCCTCGTCACCAACCGCGACATCATCTCGGAAGAC
ATTGGCGACTTTGAGTACACGCCCAAGCCCGAGTATCCGGGGGCCTTTATCATCTTCAACGAGCCCAACGAAAAG
GCCGTCATCGAACGCTTCTTCCTTCACGTCAAGGAGGCGCGGCCGACGGTCATCGCCACATACAACGGCGACTTC
TTCGACTGGCCCTTTGTCGAGGCCCGTGCTAGTATCAACGGTATCGACATGTACCAGGAGATTGGGTGGAAGAAA
GACGGCGACGACCAGTTCAAGTGCAACTACGGCGTCCACATGGACTGCTTCCACTGGGTCAACCGAGACTCGTAT
CTGCCCCAGGGGTCTCGCGGCCTCAAAGCCGTGACGGTGGCCAAGCTCGGCTACGACCCGGACGAGCTGGACCCG
GAGCTGATGACGCCGTACGCCAGGGAGCGGCCTCAGACGCTGGCCGAGTACTCTGTGTCGGACGCGGTGGCGACG
TACTACCTCTACATGAAATACGTCCATCCCTTCATCTTCTCGCTCTGCACCATCCTACCGCTCGGAGGCGACGAT
ACGCTGCGCAAGGGAACTGGCACGCTGTGCGAGATGCTGCTGATGGTGCAGGCCTATAAGAAGGAGATTGTGCTA
CCGAACAAGCACCAGTCGCCGCGCGAGGCCTTTTGGGACGGCCACCTACTCGACTCGGAGACGTACGTGGGCGGC
CACGTCGAGAGTATCGAGGCCGGTGTCTTCCGGGCCGATATCCCCGTCGACTTCTCCGTCGAGCCGGCCGCCATC
GACGAGCTGCTGCGGGACCTGGACGCCGCACTCGAGTTTGTCGTGACGGTGGAGGAGAAGAAGTCGATGGACGAC
GTGGAAAACTACGACGAGGTGCGGCGGCAGATGGCCCAGAAACTGACGGAACTGAAGGAGAGGCCCAAGAGGCAC
GAGAAGCCGCTCATCTACCACTTGGACGTGGCCTCCATGTATCCCAACATCATGACGACCAACCGCTTGCAGCCG
GACTCGATGATCTCCGAATCCGACTGTGCTGCATGTGACTTCAACCGGCCTGGCAAGACGTGCGATCGACGAATG
CCTTGGGCCTGGAGAGGCGAGTATCTGCCGGCCAAGCGGGACGAGTACAATATGATCCGCAACGCGCTCCAGGGG
GAGAAGTTTCCGGGAAAGACGGCCCAGGCACCGGCTCGGACCTTTGCCCAGCTGAGCCCTGATGAGCAGGCCGGG
CTCGTCCGCAAACGGCTGCAGCTCTACTCGCAAAAGGTGTATCACAAGATCCACGACTCGACCACCATAGTTCGC
GAGGCCATCATCTGCCAGCGCGAGAACCCCTTTTACATCAACACGGTACGCGACTTCCGTGACCGCCGCTACGAT
TACAAGGGCAAGGCCAAGGTGTGGAAGGGCAAGACGGACGAGCTCAAGTCTGCGGGCGCGACGGCGGTCGATGTC
GAGGCGGCCAAGAAGATGGTCATCGTCTACGACTCGCTGCAGTTGGCTCACAAGGTCATCCTCAACTCCTTCTAC
GGCTACGTCATGCGCAAGGGCTCGCGCTGGTACTCGATGGAGATGGCTGGCGTCACCTGCTTGACGGGCGCCCAC
ATCATCCAGATGGCCAGGCAGCTGGTCGAGCGGCTGGGAAGACCGCTCGAGCTCGACACGGACGGTATCTGGTGC
ATGCTGCCGGCCAGCTTCCCGGAGAACTTTACGCTGAGGCTGAAGAATGGTAAGAAGATGGGCATCTCTTATCCC
TGCGTCATGCTCAACCATCTGGTGCACGCCCGCTTCACAAACGACCAGTACCAGACGCTGGTCGACGGCCGGACG
TTCCGGTACGAGACGCACAGCGACAACTCCATCTTCTTCGAAGTCGACGGGCCGTACCGGGCCATGGTACTGCCC
ACGTCCAAGGAGGAGGACAAGAACCTCAAGAAGCGCTACGCCGTCTTCAACCACGACGGCAGCCTGGCCGAGCTC
AAGGGCTTCGAGGTGAAACGGCGAGGCGAGCTCAAGCTCATCAAGATCTTCCAGCAGCAAATCTTCCGCTTCTTC
CTCGAAGGCCGCGATCTGGCCGAGTGCTACAGCGCCGTGGCTCAGGTGGCCAACCGCTGGCTGGACGTGCTCGAC
AACAAGGGCACGACGCTGGCCGACGAGGAGCTGATGGACCTCATCTCGGAGAACCGGAGCATGTCCAAGACGCTG
GAAGAGTACGGAGGACAAAAGTCGACGAGCATCACCACGGCCCGCCGGCTGGCCGACTTTCTAGGCGACCAGATG
GTCAAAGACAAGGGGCTCAACTGCAAGTTCATCATCTGTTCCAAGCCTCGCAACGCACCCGTGACCCAGCGGGCC
GTTCCCGTCGCCATCTTCTCCGCCGACGAGACCGTCAAGCGGACCTACCTCCGCAAGTGGCTCAAGGAGGACCCG
TCCGACACGGACCCGAGGGCGCTGCTGGACTGGTCCTACTACGCCGAACGGCTGGGGTCTGTCATCCAGAAGCTC
ATCACGATCCCCGCGGCGCTGCAAAAGGTCAGGAATCCGGTGCCGCGGGTGCCGCATCCGGAGTGGCTTCAGCGG
AGGATCAGGATCAAGGACGACAAGATGAAGCAGATGAAGCTGACGGACGGTCTGCTGAGCAAGCTCGAGAACGAC
ATGGAGGACTTTGGGGCGGTGGCCAAGCAGCTTCTGGGGCCCAAGCCGGTGGGCGAGGCTGTGGCATCGTCCATG
ATGCGTGAGACGGAGGAGAAGAACAAGATGATGATGATGATGATGAAGAAGAAGAAGAAGAAGCGCAAGTCACCC
GACGAAGCGGCGGATGACGAGAACGAACCCCCCCTGCCAAGCAAAGCGCCTAGCCCATCGGAGAACTACTCGGCC
TTTCTGGCGTACGAAAAGAGGAAGTGGAAGATGCAGAAGCAGGCTCGCGTCCGCAGGAGGCAGCTCTTTGGCGAG
AGGAGAAGCACCAATATGCAAGGCAATAACAACATCCAGCAGACGTTCCGGAAGCAGGCCCACGATACCTTTATG
AGGCCCTGGCAGCTGCTGCAGCTCAAAGACACGGACAGTCCCGGGACGGTGGCGGCATACGTGCTGATTGACGGC
AAGATGCACCACCTCAAGATACGGGTGAATCGGCAGGTCTACCTTAACCTCAAGAGCGAGCGTCTCCCGGACGTG
GACATTGCCGGATGTGAGGTGGAACAGGTGCAGCACACGCTTCCCAACGGACACGCGTCGACATACCTGTTCCGG
CTCACGGTAGGCGAGGACATCTACGTTGCCGAGGCGGACCGGTTCGATCAGCTCTTCCGGCACCCGAGCGTCGAG
GGCGTGTACGAGACACAGGTTCCGCTGAGCGTACGGGCGGTGCTGAGGTTGGGCAACGTTTGTACCGTCGACGAC
CAGCGGCAGGGCGTCCTGGGCAGGGGGCTGGAGACGGGCTTCGAGCTGGACGGGCTGAAGCGGCCTCAGAAGACG
GCCTACCTGGAGTCGTGGCCACTGGCGTACGTCTTCGTCTCGCACATGACGGCCGGCGAACGACAGGTGTTTGGC
CTGTTCTCGAGCTCCGGTGACGAGGCTCACGTCGTCATCGTCGGCGGTGGAGGCCAGGACGTGATGATGCCCAAC
ATGAGCAACCTGTACGACGACATGTTGGCAGCGAGGCGGTCAGAAGCGGACAGCAACTGGCAAGACTGCTTCCGC
TACCAGGAGAGACTTCGCTTCCGGACGAAACAGGTGACGACACGACGCAAGGCCCAGCTAGAGGTGGCCGATGTG
GTGCGAAGGATGCGTCGGGACGAGACCGGGCCGCTGCTGGCCGTCGTCCGGTCACCGCATCGGGAGCAACTGGTG
GTCGACGTCCCGGTGCTGGCCCATCTCCCGCTGCTGACGCTCCCCTACGACTCGGCAGACGGGGCGTGGCCTCCG
CTGGGCTGGCAGACGACGGCCGCCCGGAGGCTGGTTGCTCAGTATCTCGGGCTCGGATCGTGGGTGGCTCATCTC
ACGGCGCTGGCCCGGTACGGTGACGTTCCGCTATGCAACCTGGACCGTGACGACGCCCGATTCCTCATCGACGTG
GCCTACGCCCGTCGGCTACAGGCCAATGGCGTCGTTCTCTGGTGGTCTCCCGGCCCGCGTCCGGACCACGGCGGT
CACGAGCGGGATGCCGTGCCGACGGCAGCGACTCGGCTCGGGGCCGTCAACAGCGCCGGGTCTTCGGCCGGAACC
GTCTGTCTCGACGTCGAGGTCCGTAACCTGGCCGTCAACACGATGCTGACGTCTTCGCTCATCAACGAGCTCGAG
GGCGCCGCTTCGGATCACGACGTGCTCGTCTCAGACAAGGCCTTCTCGCGCGCTGCCGTCGTCGTTCTCGGCGAC
ATGGTCAAGGCTTGGTGGGCAGAAGCCTGCCGCGGCGGTACGATGGCCGACATCCTCGTCCAGCACCTGGTCCGT
TGGGTCGAGAGCAGACGCTCGTTCCTCTTCGACGAGGCTCTACACCAGCACGTCCTCATGATGTCTCGCAAGGCT
CTACAGCAGCTCATGGCCGACTTCCGCCGCCTCGGCTGCCAGATCATCTTCACCAGCGCCGACCGCATCATGCTG
CGAACTACAAAGGCAGAGGTCGGCACCGCCTTTGCCTTTGGCGAGTACATGGTCAAGTCGATCAAGGCCCGGCCT
CTCTTCCACTTCATCGACCTGGAGATCCGCGGCTACTGGGACTATCTTGTCTGGTACGACGAGCACAACTACGGC
GGCCGAGTCTGTCGCCAAAGAGTTCTAGAGACGGACGAGGTCCAACAGCAGCTGGAGACGGTCATGCACTGGCAG
ATGGCCACCTTTTTGCCCCGGCTCCTGCAGCCCGTGTTCGAGGAGCTGACGACGGCGTTTGTCGAGCGGATGCAT
CGTCTGAAGCGCGGTGCCTTTAACGAGCTCGATGATGAGGAGGAGGAGGAGGAGGAGGAGGCTGTCGAAGCGGGT
GATGCAGGTTCAACGCCACCGCGGCCTACGCAGCTTCCCAAGAAGAAGGGAGCCGATGACGAGGACGAAAAGCGC
ATCGTCCTCGGAAAGCCTCTGATGAAGACGATAGAAAAGACGCTCGCCAGCGTCACGGCCCGACAGAGACGAGAA
CTCCTCCATCCAGAGCTCGCCTCCGACTACGGATTCCCAAAGGACCTCCCCGGCCGACACCTCACGCCAACGAAC
CCGAGCCTGGAACTCTCCAAGACAATCCTCCAAGTCCTCTCGCTCGAACGCAGCGCCACGCCCGAGACACGTCGT
CTCCGCCGCGACGTCCTCTCCCGCCTCTTCTCCATCAACGACTTCTCCCGCGAAGCCTCCTTCGCGAACCCCTCC
TCGTCGCTTCGTCTGGAGCAGGTCTCGTGCGACAACTGCACGCTGGCGCGGGATCTGGACCTGTGTCGCGACGAG
GCCTTGCTGGCGGGTAGGCCGTGGCGATGTCCGCTCTGCGGCGTGCCGTACGACGAGGTCGCGTTGGAGGAGAGG
GTCTTGGGTTTGGCTTGGGGGGGCGTCGCCGAGTGGGCCGTCATGGATGTTGTTTCTTTTTGA
Gene >Ophcf2|05211
ATGCCCAACACAAGTCTCCGTCGCCCGCAAAAGGGGTTCCGCCGCGGCGGCAAGACGGCCTACCATGGCGGCCGG
AAGACGTTTACCGCCTCGTCCCGGGCCGAAGGCACCTCGATCGCCGAAAAGTGGGAGAAAACTCAGCTGGCAAAC
TCCATCGACGAGAACATGGGCTTCGCCCGTTACGAGAGCGGCAAGCGCAGGGACGGCTGGCTCGTCAGTGTGCAG
TCGACTTCGATCCACGATGAGCGCATACCAGGAGGTCGAGCCGCGCTCGACTGCTACTTCATCGAGGCCGAGGGA
GACACCTTCAAGGCCACGGTTGAATACGACCCCTACTTCCTCATCGCCGTCAGGAGAGGCCGCGAGGCCGACGTC
GAGGAATGGGCCAAGCGCGTTCCCGGTGGCGGCGTCGTCAAGACGATCCGCAGGGTCGAAAAAGACGACTTGAAG
ATGCCAAATCATCTACTGGGCCACCGACGGACCTTTCTAGAGCTCCGGTTCGCTAACGTCGGCGATCTGATGGCG
GCCAGAAAAGACATCATCCCGGTGGCGGAAAAGAACAAGAAGAATATGGATGCCATCGATACGTATGCCGAGGTT
GTCATGGCCAGTGGCGACGTGGACTTGTTCGACGACGACGACATGCGCGACGATGGCAAGACGTTCAAGGAAGCC
AGCGACTTCATCATCGACATCCGCGAGTACGATGTGCCCTACCATGTGAGGGTCATGATCGATCTCGGTGAGCCC
CTGACTTCTTGCACTTGCGCTCATCTTGATGCTGATTGAGTCTTGCCGCAGATATACGAGTGGGCAAGTGGTATT
TTGTCGAGGCCAAACACGGCACCACCAGGATCTGGGCAAACGAAGAGCGTTCTTTACCCGCGGACCCTACCGTAC
TGGCGTTCGATATAGAGACGACGAAGCTACCACTCAAATTCCCCGACGCCACTGTGGACCAGATCATGATGATCT
CGTACATGATTGACGGCCAGGGCTTCCTCGTCACCAACCGCGACATCATCTCGGAAGACATTGGCGACTTTGAGT
ACACGCCCAAGCCCGAGTATCCGGGGGCCTTTATCATCTTCAACGAGCCCAACGAAAAGGCCGTCATCGAACGCT
TCTTCCTTCACGTCAAGGAGGCGCGGCCGACGGTCATCGCCACATACAACGGCGACTTCTTCGACTGGCCCTTTG
TCGAGGCCCGTGCTAGTATCAACGGTATCGACATGTACCAGGAGATTGGGTGGAAGAAAGACGGCGACGACCAGT
TCAAGTGCAACTACGGCGTCCACATGGACTGCTTCCACTGGGTCAACCGAGACTCGTATCTGCCCCAGGGGTCTC
GCGGCCTCAAAGCCGTGACGGTGGCCAAGCTCGGCTACGACCCGGACGAGCTGGACCCGGAGCTGATGACGCCGT
ACGCCAGGGAGCGGCCTCAGACGCTGGCCGAGTACTCTGTGTCGGACGCGGTGGCGACGTACTACCTCTACATGA
AATACGTCCATCCCTTCATCTTCTCGCTCTGCACCATCCTACCGCTCGGAGGCGACGATACGCTGCGCAAGGGAA
CTGGCACGCTGTGCGAGATGCTGCTGATGGTGCAGGCCTATAAGAAGGAGATTGTGCTACCGAACAAGCACCAGT
CGCCGCGCGAGGCCTTTTGGGACGGCCACCTACTCGACTCGGAGACGTACGTGGGCGGCCACGTCGAGAGTATCG
AGGCCGGTGTCTTCCGGGCCGATATCCCCGTCGACTTCTCCGTCGAGCCGGCCGCCATCGACGAGCTGCTGCGGG
ACCTGGACGCCGCACTCGAGTTTGTCGTGACGGTGGAGGAGAAGAAGTCGATGGACGACGTGGAAAACTACGACG
AGGTGCGGCGGCAGATGGCCCAGAAACTGACGGAACTGAAGGAGAGGCCCAAGAGGCACGAGAAGCCGCTCATCT
ACCACTTGGACGTGGCCTCCATGTATCCCAACATCATGACGACCAACCGCTTGCAGCCGGACTCGATGATCTCCG
AATCCGACTGTGCTGCATGTGACTTCAACCGGCCTGGCAAGACGTGCGATCGACGAATGCCTTGGGCCTGGAGAG
GCGAGTATCTGCCGGCCAAGCGGGACGAGTACAATATGATCCGCAACGCGCTCCAGGGGGAGAAGTTTCCGGGAA
AGACGGCCCAGGCACCGGCTCGGACCTTTGCCCAGCTGAGCCCTGATGAGCAGGCCGGGCTCGTCCGCAAACGGC
TGCAGCTCTACTCGCAAAAGGTGTATCACAAGATCCACGACTCGACCACCATAGTTCGCGAGGCCATCATCTGCC
AGCGCGAGAACCCCTTTTACATCAACACGGTACGCGACTTCCGTGACCGCCGCTACGATTACAAGGGCAAGGCCA
AGGTGTGGAAGGGCAAGACGGACGAGCTCAAGTCTGCGGGCGCGACGGCGGTCGATGTCGAGGCGGCCAAGAAGA
TGGTCATCGTCTACGACTCGCTGCAGTTGGCTCACAAGGTCATCCTCAACTCCTTCTACGGCTACGTCATGCGCA
AGGGCTCGCGCTGGTACTCGATGGAGATGGCTGGCGTCACCTGCTTGACGGGCGCCCACATCATCCAGATGGCCA
GGCAGCTGGTCGAGCGGCTGGGAAGACCGCTCGAGCTCGACACGGACGGTATCTGGTGCATGCTGCCGGCCAGCT
TCCCGGAGAACTTTACGCTGAGGCTGAAGAATGGTAAGAAGATGGGCATCTCTTATCCCTGCGTCATGCTCAACC
ATCTGGTGCACGCCCGCTTCACAAACGACCAGTACCAGACGCTGGTCGACGGCCGGACGTTCCGGTACGAGACGC
ACAGCGACAACTCCATCTTCTTCGAAGTCGACGGGCCGTACCGGGCCATGGTACTGCCCACGTCCAAGGAGGAGG
ACAAGAACCTCAAGAAGCGCTACGCCGTCTTCAACCACGACGGCAGCCTGGCCGAGCTCAAGGGCTTCGAGGTGA
AACGGCGAGGCGAGCTCAAGCTCATCAAGATCTTCCAGCAGCAAATCTTCCGCTTCTTCCTCGAAGGCCGCGATC
TGGCCGAGTGCTACAGCGCCGTGGCTCAGGTGGCCAACCGCTGGCTGGACGTGCTCGACAACAAGGGCACGACGC
TGGCCGACGAGGAGCTGATGGACCTCATCTCGGAGAACCGGAGCATGTCCAAGACGCTGGAAGAGTACGGAGGAC
AAAAGTCGACGAGCATCACCACGGCCCGCCGGCTGGCCGACTTTCTAGGCGACCAGATGGTCAAAGACAAGGGGC
TCAACTGCAAGTTCATCATCTGTTCCAAGCCTCGCAACGCACCCGTGACCCAGCGGGCCGTTCCCGTCGCCATCT
TCTCCGCCGACGAGACCGTCAAGCGGACCTACCTCCGCAAGTGGCTCAAGGAGGACCCGTCCGACACGGACCCGA
GGGCGCTGCTGGACTGGTCCTACTACGCCGAACGGCTGGGGTCTGTCATCCAGAAGCTCATCACGATCCCCGCGG
CGCTGCAAAAGGTCAGGAATCCGGTGCCGCGGGTGCCGCATCCGGAGTGGCTTCAGCGGAGGATCAGGATCAAGG
ACGACAAGATGAAGCAGATGAAGCTGACGGACGGTCTGCTGAGCAAGCTCGAGAACGACATGGAGGACTTTGGGG
CGGTGGCCAAGCAGCTTCTGGGGCCCAAGCCGGTGGGCGAGGCTGTGGCATCGTCCATGATGCGTGAGACGGAGG
AGAAGAACAAGATGATGATGATGATGATGAAGAAGAAGAAGAAGAAGCGCAAGTCACCCGACGAAGCGGCGGATG
ACGAGAACGAACCCCCCCTGCCAAGCAAAGCGCCTAGCCCATCGGAGAACTACTCGGCCTTTCTGGCGTACGAAA
AGAGGAAGTGGAAGATGCAGAAGCAGGCTCGCGTCCGCAGGAGGCAGCTCTTTGGCGAGAGGAGAAGCACCAATA
TGCAAGGCAATAACAACATCCAGCAGACGTTCCGGAAGCAGGCCCACGATACCTTTATGAGGCCCTGGCAGCTGC
TGCAGCTCAAAGACACGGACAGTCCCGGGACGGTGGCGGCATACGTGCTGATTGACGGCAAGATGCACCACCTCA
AGATACGGGTGAATCGGCAGGTCTACCTTAACCTCAAGAGCGAGCGTCTCCCGGACGTGGACATTGCCGGATGTG
AGGTGGAACAGGTGCAGCACACGCTTCCCAACGGACACGCGTCGACATACCTGTTCCGGCTCACGGTAGGCGAGG
ACATCTACGTTGCCGAGGCGGACCGGTTCGATCAGCTCTTCCGGCACCCGAGCGTCGAGGGCGTGTACGAGACAC
AGGTTCCGCTGAGCGTACGGGCGGTGCTGAGGTTGGGCAACGTTTGTACCGTCGACGACCAGCGGCAGGGCGTCC
TGGGCAGGGGGCTGGAGACGGGCTTCGAGCTGGACGGGCTGAAGCGGCCTCAGAAGACGGCCTACCTGGAGTCGT
GGCCACTGGCGTACGTCTTCGTCTCGCACATGACGGCCGGCGAACGACAGGTGTTTGGCCTGTTCTCGAGCTCCG
GTGACGAGGCTCACGTCGTCATCGTCGGCGGTGGAGGCCAGGACGTGATGATGCCCAACATGAGCAACCTGTACG
ACGACATGTTGGCAGCGAGGCGGTCAGAAGCGGACAGCAACTGGCAAGACTGCTTCCGCTACCAGGAGAGACTTC
GCTTCCGGACGAAACAGGTGACGACACGACGCAAGGCCCAGCTAGAGGTGGCCGATGTGGTGCGAAGGATGCGTC
GGGACGAGACCGGGCCGCTGCTGGCCGTCGTCCGGTCACCGCATCGGGAGCAACTGGTGGTCGACGTCCCGGTGC
TGGCCCATCTCCCGCTGCTGACGCTCCCCTACGACTCGGCAGACGGGGCGTGGCCTCCGCTGGGCTGGCAGACGA
CGGCCGCCCGGAGGCTGGTTGCTCAGTATCTCGGGCTCGGATCGTGGGTGGCTCATCTCACGGCGCTGGCCCGGT
ACGGTGACGTTCCGCTATGCAACCTGGACCGTGACGACGCCCGATTCCTCATCGACGTGGCCTACGCCCGTCGGC
TACAGGCCAATGGCGTCGTTCTCTGGTGGTCTCCCGGCCCGCGTCCGGACCACGGCGGTCACGAGCGGGATGCCG
TGCCGACGGCAGCGACTCGGCTCGGGGCCGTCAACAGCGCCGGGTCTTCGGCCGGAACCGTCTGTCTCGACGTCG
AGGTCCGTAACCTGGCCGTCAACACGATGCTGACGTCTTCGCTCATCAACGAGCTCGAGGGCGCCGCTTCGGATC
ACGACGTGCTCGTCTCAGACAAGGCCTTCTCGCGCGCTGCCGTCGTCGTTCTCGGCGACATGGTCAAGGCTTGGT
GGGCAGAAGCCTGCCGCGGCGGTACGATGGCCGACATCCTCGTCCAGCACCTGGTCCGTTGGGTCGAGAGCAGAC
GCTCGTTCCTCTTCGACGAGGCTCTACACCAGCACGTCCTCATGATGTCTCGCAAGGCTCTACAGCAGCTCATGG
CCGACTTCCGCCGCCTCGGCTGCCAGATCATCTTCACCAGCGCCGACCGCATCATGCTGCGAACTACAAAGGCAG
AGGTCGGCACCGCCTTTGCCTTTGGCGAGTACATGGTCAAGTCGATCAAGGCCCGGCCTCTCTTCCACTTCATCG
ACCTGGAGATCCGCGGCTACTGGGACTATCTTGTCTGGTACGACGAGCACAACTACGGCGGCCGAGTCTGTCGCC
AAAGAGTTCTAGAGACGGACGAGGTCCAACAGCAGCTGGAGACGGTCATGCACTGGCAGATGGCCACCTTTTTGC
CCCGGCTCCTGCAGCCCGTGTTCGAGGAGCTGACGACGGCGTTTGTCGAGCGGATGCATCGTCTGAAGCGCGGTG
CCTTTAACGAGCTCGATGATGAGGAGGAGGAGGAGGAGGAGGAGGCTGTCGAAGCGGGTGATGCAGGTTCAACGC
CACCGCGGCCTACGCAGCTTCCCAAGAAGAAGGGAGCCGATGACGAGGACGAAAAGCGCATCGTCCTCGGAAAGC
CTCTGATGAAGACGATAGAAAAGACGCTCGCCAGCGTCACGGCCCGACAGAGACGAGAACTCCTCCATCCAGAGC
TCGCCTCCGACTACGGATTCCCAAAGGACCTCCCCGGCCGACACCTCACGCCAACGAACCCGAGCCTGGAACTCT
CCAAGACAATCCTCCAAGTCCTCTCGCTCGAACGCAGCGCCACGCCCGAGACACGTCGTCTCCGCCGCGACGTCC
TCTCCCGCCTCTTCTCCATCAACGACTTCTCCCGCGAAGCCTCCTTCGCGAACCCCTCCTCGTCGCTTCGTCTGG
AGCAGGTCTCGTGCGACAACTGCACGCTGGCGCGGGATCTGGACCTGTGTCGCGACGAGGCCTTGCTGGCGGGTA
GGCCGTGGCGATGTCCGCTCTGCGGCGTGCCGTACGACGAGGTCGCGTTGGAGGAGAGGGTCTTGGGTTTGGCTT
GGGGGGGCGTCGCCGAGTGGGCCGTCATGGATGTTGTTTGTGAGAGGTGTGGGGGGGAGGGTCAACGAGTTTATG
GAGCATTGTGGGTGTGGGGGGGGATGGAAGGGCGTTATGGAAGGGAAGGGGACGGGGGTGACGGGGGCGACCTTG
AGGGGGGTTGCTGGCTTTTACGGGTTGAAGATGGTTGGGGAGGCGGTCGAGGAGGTTTGGGGGGGCTTGCTGTGT
AGGGAGGTGTTTTGGGTAGCTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail