Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05208
Gene name
Locationscaffold_05:2774586..2775293
Strand-
Gene length (bp)707
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12597 Cox20 Cytochrome c oxidase assembly protein COX20 7.2E-35 33 132

GO

GO Term Description Terminal node
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0008535 respiratory chain complex IV assembly No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0031966 mitochondrial membrane No
GO:0022607 cellular component assembly No
GO:0017004 cytochrome complex assembly No
GO:0009987 cellular process No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0008150 biological_process No
GO:0065003 protein-containing complex assembly No
GO:0016020 membrane No
GO:0019866 organelle inner membrane No
GO:0031090 organelle membrane No
GO:0110165 cellular anatomical entity No
GO:0071840 cellular component organization or biogenesis No
GO:0043933 protein-containing complex organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 85 104 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05208
MHDQPPNDPNEQRHPPETLHWPRPSPESERPPQPTISEAVATISKEDFLTIASKPCAREGLLTGIATGSLAGGLK
FLLHGNVPKAANWAVGIFLVGSTASYEYCQFRRRAQRRAMVRQIEVVNDHRREVARKAVEEKRARRTEEEERAQA
QKSWYRFW*
Coding >Ophcf2|05208
ATGCACGACCAACCCCCCAATGACCCCAATGAGCAGAGACACCCCCCCGAAACCCTCCACTGGCCCAGGCCCAGC
CCCGAATCCGAACGACCCCCCCAACCAACCATCTCCGAAGCCGTCGCAACAATAAGCAAAGAAGACTTCCTCACC
ATCGCCAGCAAGCCCTGCGCAAGAGAAGGTCTCCTCACAGGCATCGCAACCGGCTCTCTAGCCGGCGGCCTCAAA
TTCCTCCTCCACGGGAACGTACCCAAGGCAGCGAACTGGGCCGTCGGCATCTTCCTCGTCGGGAGCACGGCTTCG
TATGAATATTGTCAGTTTCGGAGGCGTGCGCAGCGGAGGGCCATGGTGAGGCAGATTGAGGTGGTGAATGATCAT
CGGAGGGAGGTTGCGCGCAAGGCGGTTGAGGAGAAGAGGGCGAGGAGGACAGAGGAGGAGGAGAGGGCTCAGGCG
CAGAAGTCGTGGTATAGGTTTTGGTAG
Transcript >Ophcf2|05208
ATGCACGACCAACCCCCCAATGACCCCAATGAGCAGAGACACCCCCCCGAAACCCTCCACTGGCCCAGGCCCAGC
CCCGAATCCGAACGACCCCCCCAACCAACCATCTCCGAAGCCGTCGCAACAATAAGCAAAGAAGACTTCCTCACC
ATCGCCAGCAAGCCCTGCGCAAGAGAAGGTCTCCTCACAGGCATCGCAACCGGCTCTCTAGCCGGCGGCCTCAAA
TTCCTCCTCCACGGGAACGTACCCAAGGCAGCGAACTGGGCCGTCGGCATCTTCCTCGTCGGGAGCACGGCTTCG
TATGAATATTGTCAGTTTCGGAGGCGTGCGCAGCGGAGGGCCATGGTGAGGCAGATTGAGGTGGTGAATGATCAT
CGGAGGGAGGTTGCGCGCAAGGCGGTTGAGGAGAAGAGGGCGAGGAGGACAGAGGAGGAGGAGAGGGCTCAGGCG
CAGAAGTCGTGGTATAGGTTTTGGTAG
Gene >Ophcf2|05208
ATGCGTAAACATTCATCCATACATATTGTACGAGTACCTACATCACGAACCACAATCCCTCATCTTCCCAACAAA
CACAACCTACCCTAAACCAACCTTCGGCCCGACCACCTCCGCCTCAACCCACCCTCACCCCCATCACCAACCACA
ACCCTTTCCAAACAGACGACCAACCCCCCAATGACCCCAATGAGCAGAGACACCCCCCCGAAACCCTCCACTGGC
CCAGGCCCAGCCCCGAATCCGAACGACCCCCCCAACCAACCATCTCCGAAGCCGTCGCAACAATAAGCAAAGAAG
ACTTCCTCACCATCGCCAGCAAGCCCTGCGCAAGAGAAGGTCTCCTCACAGGCATCGCAACCGGCTCTCTAGCCG
GCGGCCTCAAATTCCTCCTCCACGGTTCGTGTCCACGTCTCCTGCAGTTGGACAAGGCATCGTCGCTTACACACA
CACACACATCACGTCAAGGGAACGTACCCAAGGCAGCGAACTGGGCCGTCGGCATCTTCCTCGTCGGGAGCACGG
CTTCGTATGAATATTGTCAGTTTCGGAGGCGTGCGCAGCGGAGGGCCATGGTGAGGCAGATTGAGGTGGTGAATG
ATCATCGGAGGGAGGTTGCGCGCAAGGCGGTTGAGGAGAAGAGGGCGAGGAGGACAGAGGAGGAGGAGAGGGCTC
AGGCGCAGAAGTCGTGGTATAGGTTTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail