Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05199
Gene name
Locationscaffold_05:2762825..2763503
Strand+
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.534 0.6498 0.1559 0.0513 0.2659 0.0412 0.1082 0.0371 0.0484 0.1215

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1177
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2742
Ophiocordyceps australis map64 (Brazil) OphauB2|6595
Ophiocordyceps camponoti-floridani Ophcf2|05199 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05200
Ophiocordyceps camponoti-rufipedis Ophun1|5096
Ophiocordyceps kimflemingae Ophio5|4712
Ophiocordyceps subramaniannii Hirsu2|103

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05199
MSETTMADKISHFSQVIMAASKLIIENDSHTKAQANHLPEAAYISVLAQAVKNAKDTAAEAVAESGRCNYDAKTF
KRFCKAEINEYLDVVSEYAEFRRGVAEAISSFEVPNGKQSAAFMQIAAWKLGLETNRNQAELNLLLKGDVVEGIS
DLSEFRAVEIEALSREIQIGRKNIMQLLEAPLNRTSRTGADANQNQVSDGSAAGYRRRSQSQKKRYRFKGHLVGA
*
Coding >Ophcf2|05199
ATGTCCGAGACAACGATGGCCGACAAGATCAGCCACTTCTCACAAGTCATCATGGCAGCCTCCAAGCTGATTATC
GAAAACGACAGCCATACTAAAGCCCAAGCCAACCACCTACCCGAAGCGGCATACATATCCGTACTCGCCCAGGCA
GTCAAGAACGCCAAGGACACAGCCGCCGAAGCCGTGGCTGAATCCGGACGATGCAACTACGACGCCAAAACATTC
AAGCGCTTCTGCAAGGCCGAGATCAACGAATACCTCGACGTCGTCAGCGAGTACGCAGAGTTCAGGAGAGGGGTA
GCGGAGGCCATTTCCAGCTTCGAGGTCCCAAACGGGAAGCAATCCGCCGCCTTTATGCAGATCGCTGCCTGGAAA
CTGGGGCTCGAGACCAACCGCAACCAAGCCGAGCTCAATCTTTTGCTAAAGGGTGACGTCGTCGAAGGAATATCA
GATCTTTCGGAATTCAGGGCTGTCGAGATAGAAGCCCTCTCGAGGGAGATACAGATAGGAAGAAAAAATATCATG
CAGTTGTTGGAGGCTCCCCTGAACAGGACCAGCCGAACCGGTGCCGACGCCAATCAGAACCAGGTCTCGGACGGC
TCTGCGGCGGGATACAGAAGGAGATCTCAGAGTCAGAAGAAACGCTATCGTTTCAAGGGCCATTTAGTGGGAGCA
TGA
Transcript >Ophcf2|05199
ATGTCCGAGACAACGATGGCCGACAAGATCAGCCACTTCTCACAAGTCATCATGGCAGCCTCCAAGCTGATTATC
GAAAACGACAGCCATACTAAAGCCCAAGCCAACCACCTACCCGAAGCGGCATACATATCCGTACTCGCCCAGGCA
GTCAAGAACGCCAAGGACACAGCCGCCGAAGCCGTGGCTGAATCCGGACGATGCAACTACGACGCCAAAACATTC
AAGCGCTTCTGCAAGGCCGAGATCAACGAATACCTCGACGTCGTCAGCGAGTACGCAGAGTTCAGGAGAGGGGTA
GCGGAGGCCATTTCCAGCTTCGAGGTCCCAAACGGGAAGCAATCCGCCGCCTTTATGCAGATCGCTGCCTGGAAA
CTGGGGCTCGAGACCAACCGCAACCAAGCCGAGCTCAATCTTTTGCTAAAGGGTGACGTCGTCGAAGGAATATCA
GATCTTTCGGAATTCAGGGCTGTCGAGATAGAAGCCCTCTCGAGGGAGATACAGATAGGAAGAAAAAATATCATG
CAGTTGTTGGAGGCTCCCCTGAACAGGACCAGCCGAACCGGTGCCGACGCCAATCAGAACCAGGTCTCGGACGGC
TCTGCGGCGGGATACAGAAGGAGATCTCAGAGTCAGAAGAAACGCTATCGTTTCAAGGGCCATTTAGTGGGAGCA
TGA
Gene >Ophcf2|05199
ATGTCCGAGACAACGATGGCCGACAAGATCAGCCACTTCTCACAAGTCATCATGGCAGCCTCCAAGCTGATTATC
GAAAACGACAGCCATACTAAAGCCCAAGCCAACCACCTACCCGAAGCGGCATACATATCCGTACTCGCCCAGGCA
GTCAAGAACGCCAAGGACACAGCCGCCGAAGCCGTGGCTGAATCCGGACGATGCAACTACGACGCCAAAACATTC
AAGCGCTTCTGCAAGGCCGAGATCAACGAATACCTCGACGTCGTCAGCGAGTACGCAGAGTTCAGGAGAGGGGTA
GCGGAGGCCATTTCCAGCTTCGAGGTCCCAAACGGGAAGCAATCCGCCGCCTTTATGCAGATCGCTGCCTGGAAA
CTGGGGCTCGAGACCAACCGCAACCAAGCCGAGCTCAATCTTTTGCTAAAGGGTGACGTCGTCGAAGGAATATCA
GATCTTTCGGAATTCAGGGCTGTCGAGATAGAAGCCCTCTCGAGGGAGATACAGATAGGAAGAAAAAATATCATG
CAGTTGTTGGAGGCTCCCCTGAACAGGACCAGCCGAACCGGTGCCGACGCCAATCAGAACCAGGTCTCGGACGGC
TCTGCGGCGGGATACAGAAGGAGATCTCAGAGTCAGAAGAAACGCTATCGTTTCAAGGGCCATTTAGTGGGAGCA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail