Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05197
Gene name
Locationscaffold_05:2759704..2761117
Strand-
Gene length (bp)1413
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 14.28 6.13 22.42
Alive In ants, during behavior modification 245.35 33.40 457.30
Dead In ants, recently dead 29.24 14.63 43.85

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.001409 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05197
MGAIRAFGTIFFLASSILVTAVVGNPGAGKQIGGLQASMLAEKSPLGIFMRERLQEELGDQLFPPPYADVALDES
ILPCAYERRVLSANRKDIRVNITSMIDFEFAPASEAAIIDIMSSTARVDTSHSTWTTESFHRLNESHVYEASLSA
GPWSGSVSAEEDGLTRGRSLARMSERDVTMNVATTYLCPPRTLCRVETWTYSASIRGNSTLVPMVDAQCYEAWAR
KTYVGFPPDYETDHVDFEAGGGWLYVYYAFRRLFRLDSRIMLTNLSIPSVHKQVPQWSDFGAPYYSISKLSSPSV
PVRKHGERGDSTADFFQVLPSNFENDVWWADENKYDVRFSKHVHDVIRIPTLHYDGSPKRTQVMLEIPIPSLKRN
GERLHNKGRRGAKAKRELSRDGGLGRGVRVKLLWTDVL*
Coding >Ophcf2|05197
ATGGGCGCCATAAGAGCATTCGGCACCATCTTCTTCCTCGCCAGCTCCATCCTCGTAACGGCCGTCGTGGGGAAC
CCTGGAGCCGGCAAGCAGATTGGCGGTCTGCAGGCGTCAATGCTCGCCGAGAAGTCGCCTCTGGGTATCTTCATG
AGGGAGAGGCTGCAGGAAGAGCTGGGAGACCAGCTGTTTCCTCCGCCGTACGCCGACGTCGCTCTGGATGAGAGC
ATCTTGCCCTGCGCGTATGAGCGTCGGGTCCTCAGTGCGAACCGCAAAGACATTCGGGTTAATATCACGTCGATG
ATAGACTTTGAATTTGCCCCGGCTTCGGAGGCGGCCATCATCGACATCATGAGCTCGACTGCTCGCGTTGATACT
AGTCACTCGACTTGGACGACCGAGTCATTTCACCGTCTGAACGAGAGCCATGTATACGAGGCTAGCTTGAGCGCA
GGACCTTGGTCAGGGTCTGTCAGTGCCGAAGAGGACGGCCTCACGCGCGGACGGAGCCTGGCCCGGATGTCGGAG
AGAGACGTCACCATGAACGTGGCTACGACTTACCTCTGTCCGCCCAGGACGCTGTGCAGAGTCGAGACGTGGACG
TACAGCGCGTCCATCAGGGGTAACTCGACGCTTGTTCCCATGGTTGACGCTCAGTGTTACGAGGCTTGGGCAAGG
AAGACGTACGTTGGCTTTCCGCCCGACTATGAGACGGATCATGTCGACTTCGAGGCCGGCGGAGGCTGGCTCTAC
GTCTACTATGCCTTCCGGAGGCTCTTTCGGCTGGACTCGAGAATCATGCTCACCAACCTTTCGATCCCCTCGGTT
CACAAACAGGTTCCGCAGTGGTCCGACTTCGGGGCCCCTTACTACAGCATTTCCAAGCTCAGCAGCCCCAGTGTT
CCGGTCCGAAAACACGGCGAGAGAGGCGATTCAACAGCCGATTTCTTCCAGGTGCTACCCTCCAACTTCGAGAAC
GACGTCTGGTGGGCCGACGAGAACAAGTACGACGTCAGATTCAGCAAGCATGTTCACGACGTGATTCGCATCCCG
ACGCTGCACTACGACGGTAGCCCGAAGCGGACGCAGGTTATGCTCGAGATTCCGATCCCGAGTCTGAAGCGGAAT
GGCGAGAGGCTTCATAACAAGGGGCGTAGAGGTGCCAAGGCTAAGAGGGAGCTTTCGAGGGATGGGGGTCTGGGT
AGGGGCGTTAGGGTCAAGTTGCTCTGGACTGATGTCTTGTAG
Transcript >Ophcf2|05197
ATGGGCGCCATAAGAGCATTCGGCACCATCTTCTTCCTCGCCAGCTCCATCCTCGTAACGGCCGTCGTGGGGAAC
CCTGGAGCCGGCAAGCAGATTGGCGGTCTGCAGGCGTCAATGCTCGCCGAGAAGTCGCCTCTGGGTATCTTCATG
AGGGAGAGGCTGCAGGAAGAGCTGGGAGACCAGCTGTTTCCTCCGCCGTACGCCGACGTCGCTCTGGATGAGAGC
ATCTTGCCCTGCGCGTATGAGCGTCGGGTCCTCAGTGCGAACCGCAAAGACATTCGGGTTAATATCACGTCGATG
ATAGACTTTGAATTTGCCCCGGCTTCGGAGGCGGCCATCATCGACATCATGAGCTCGACTGCTCGCGTTGATACT
AGTCACTCGACTTGGACGACCGAGTCATTTCACCGTCTGAACGAGAGCCATGTATACGAGGCTAGCTTGAGCGCA
GGACCTTGGTCAGGGTCTGTCAGTGCCGAAGAGGACGGCCTCACGCGCGGACGGAGCCTGGCCCGGATGTCGGAG
AGAGACGTCACCATGAACGTGGCTACGACTTACCTCTGTCCGCCCAGGACGCTGTGCAGAGTCGAGACGTGGACG
TACAGCGCGTCCATCAGGGGTAACTCGACGCTTGTTCCCATGGTTGACGCTCAGTGTTACGAGGCTTGGGCAAGG
AAGACGTACGTTGGCTTTCCGCCCGACTATGAGACGGATCATGTCGACTTCGAGGCCGGCGGAGGCTGGCTCTAC
GTCTACTATGCCTTCCGGAGGCTCTTTCGGCTGGACTCGAGAATCATGCTCACCAACCTTTCGATCCCCTCGGTT
CACAAACAGGTTCCGCAGTGGTCCGACTTCGGGGCCCCTTACTACAGCATTTCCAAGCTCAGCAGCCCCAGTGTT
CCGGTCCGAAAACACGGCGAGAGAGGCGATTCAACAGCCGATTTCTTCCAGGTGCTACCCTCCAACTTCGAGAAC
GACGTCTGGTGGGCCGACGAGAACAAGTACGACGTCAGATTCAGCAAGCATGTTCACGACGTGATTCGCATCCCG
ACGCTGCACTACGACGGTAGCCCGAAGCGGACGCAGGTTATGCTCGAGATTCCGATCCCGAGTCTGAAGCGGAAT
GGCGAGAGGCTTCATAACAAGGGGCGTAGAGGTGCCAAGGCTAAGAGGGAGCTTTCGAGGGATGGGGGTCTGGGT
AGGGGCGTTAGGGTCAAGTTGCTCTGGACTGATGTCTTGTAG
Gene >Ophcf2|05197
ATGGGCGCCATAAGAGCATTCGGCACCATCTTCTTCCTCGCCAGCTCCATCCTCGTAACGGCCGTCGTGGGGAAC
CCTGGAGCCGGCAAGCAGATTGGCGGTCTGCAGGCGTCAATGCTCGCCGAGAAGTCGCCTCTGGGTATCTTCATG
AGGGAGAGGCTGCAGGAAGAGCTGGGAGACCAGCTGTTTCCTCCGCCGTACGCCGACGTCGCTCTGGATGAGAGC
ATCTTGCCCTGCGCGTATGAGCGTCGGGTCCTCAGTGCGAACCGCAAAGACATTCGGGTTAATATCACGTCGATG
ATAGACTTTGAATTTGCCCCGGCTTCGGAGGCGGCCATCATCGACATCATGAGCTCGACTGCTCGCGTTGATACT
AGTCACTCGACTTGGACGACCGAGTCATTTCACCGTCTGAACGAGAGCCATGTATACGAGGCTAGCTTGAGCGCA
GGACCTTGGTCAGGGTCTGTCAGTGCCGAAGAGGACGGCCTCACGCGCGGACGGAGCCTGGCCCGGATGTCGGAG
AGAGACGTCACCATGAACGTGGCTACGACTTACCTCTGTCCGCCCAGGACGCTGTGCAGAGTCGAGACGTGGACG
TACAGCGCGTCCATCAGGGGTAACTCGACGCTTGTTCCCATGGTTGACGCTCAGTGTTACGAGGCTTGGGCAAGG
AAGACGTACGTTGGCTTTCCGCCCGACTATGAGACGGATCATGTCGACTTCGAGGCCGGCGGAGGCTGGCTCTAC
GTCTACTATGCCTTCCGGAGGCTCTTTCGGCTGGACTCGAGAATCATGCTCACCAACCTTTCGATCCCCTCGGTT
CACAAACAGGTTCCGCAGTGGTCCGACTTCGGGGCCCCTTACTACAGCATTTCCAAGCTCAGCAGCCCCAGTGTT
CCGGTCCGAAAACACGGCGAGAGAGGCGATTCAACAGCCGATTTCTTCCAGGTGCTACCCTCCAACTTCGAGAAC
GACGTCTGGTGGGCCGACGAGAACAAGTACGACGTCAGATTCAGCAAGCATGTTCACGACGTGATTCGCATCCCG
ACGCTGCACTACGACGGTAGCCCGAAGCGGACGCAGGTTATGCTCGAGATTCCGATCCCGAGTCTGAAGCGGAAT
GGCGAGAGGCTTCATAACAAGGGGCGTAGAGGTGCCAAGGCTAAGAGGGAGCTTTCGAGGGATGGGGGTCTGGGT
AGGGGCGTTAGGGTCAAGTTGCTCTGGACTGATGTCTGTAAGCAAGGGAGTCGGAAGGAGGATCGGCGGGATTGC
GGATGGGGGAGGGGAGGGTTTAGGGGTTGGTTGTTGACGTCGTGTTGACTGAGCAAGTCTTTGGCTGTGAAGGAA
GGGGAGCTTTGGGGTTGTTAGAGGCTGTTGGCTTGATGACACTGTTGCCGTCTTTAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail