Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05196
Gene name
Locationscaffold_05:2759177..2759452
Strand-
Gene length (bp)275
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0813 0.0709 0.9463 0.062 0.0845 0.032 0.0696 0.1402 0.0513 0.0132

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99965

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup203
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1057
Ophiocordyceps australis map64 (Brazil) OphauB2|6505
Ophiocordyceps australis map64 (Brazil) OphauB2|7186
Ophiocordyceps camponoti-floridani Ophcf2|05196 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05197
Ophiocordyceps camponoti-rufipedis Ophun1|5097
Ophiocordyceps kimflemingae Ophio5|8170
Ophiocordyceps subramaniannii Hirsu2|1068
Ophiocordyceps subramaniannii Hirsu2|2263
Ophiocordyceps subramaniannii Hirsu2|5885

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05196
MLPIASLILLGAGLASSGTVTSSIASLLDEIERDPHPCQAFCRNGMHLVCKDFNGYSFCDHQSVAKLGGSDCR*
Coding >Ophcf2|05196
ATGCTCCCCATCGCAAGCCTCATCCTCCTCGGCGCCGGCCTCGCCTCTTCCGGGACCGTCACCTCTTCCATCGCC
AGCCTCCTCGACGAAATCGAGCGCGATCCCCATCCGTGCCAGGCCTTCTGCCGCAATGGCATGCACCTCGTGTGC
AAGGACTTTAACGGATACTCCTTCTGTGATCATCAGAGCGTGGCGAAATTGGGTGGAAGCGACTGCAGGTAG
Transcript >Ophcf2|05196
ATGCTCCCCATCGCAAGCCTCATCCTCCTCGGCGCCGGCCTCGCCTCTTCCGGGACCGTCACCTCTTCCATCGCC
AGCCTCCTCGACGAAATCGAGCGCGATCCCCATCCGTGCCAGGCCTTCTGCCGCAATGGCATGCACCTCGTGTGC
AAGGACTTTAACGGATACTCCTTCTGTGATCATCAGAGCGTGGCGAAATTGGGTGGAAGCGACTGCAGGTAG
Gene >Ophcf2|05196
ATGCTCCCCATCGCAAGCCTCATCCTCCTCGGCGCCGGCCTCGCCTCTTCCGGGACCGTCACCTCTTCCATCGCC
AGCCTCCTCGACGAAATCGAGCGCGATCCCCATCCGTGCCAGGCCTTCTGCCGCAATGGCATGCACCTCGTGTGC
AAGGACTTTAACGGATACTCCTTCTGTGATCATCAGAGCGTGGCGAAATTGGTCTGCTGCCGCTTGTGGCGCTTC
AGGCCCAGGTGTGATTGCGATGTTACCAGGGTGGAAGCGACTGCAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail