Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05194
Gene name
Locationscaffold_05:2740897..2751809
Strand-
Gene length (bp)10912
Transcript length (bp)6387
Coding sequence length (bp)6387
Protein length (aa) 2129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09421 FRQ Frequency clock protein 0.0E+00 113 1077
PF07156 Prenylcys_lyase Prenylcysteine lyase 6.6E-45 1224 1453
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.1E-10 1080 1143
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.3E-05 1086 1158

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0030328 prenylcysteine catabolic process Yes
GO:0007623 circadian rhythm Yes
GO:0016491 oxidoreductase activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0005737 cytoplasm Yes
GO:0003824 catalytic activity No
GO:0042219 cellular modified amino acid catabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0009056 catabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0080090 regulation of primary metabolic process No
GO:0043226 organelle No
GO:0050794 regulation of cellular process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0048511 rhythmic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0030329 prenylcysteine metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5477 0.5563 0.6052 0.1212 0.1737 0.0537 0.0821 0.0763 0.0938 0.0228

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2740
Ophiocordyceps australis map64 (Brazil) OphauB2|6593
Ophiocordyceps camponoti-floridani Ophcf2|05194 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5099
Ophiocordyceps kimflemingae Ophio5|6046
Ophiocordyceps subramaniannii Hirsu2|240

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05194
MCWPDDEGSYTAFRSPLISTSPGHRSHRGEKAIILHLKKKISLAGKPLASRCPPAQPSSSGTRHSYVTEPPVRLI
PPAHRHARLARLHLQTCLLNEFTIMPFTERPSHGTQPPPPFPTGHPLPRRASPANSITLRHHRLARDASLRASPG
SGTQKNKMMASSPRRNSSGDSHVTGQSDPKKWFDLSNQNPTATFDNNIMDVDPPFFQKESDSSNEEKAYPYPNPA
VPPRLAVAQSSSADDYRSVIDDLTVEIQKLKEQLKRYKQSGPDMMRKDKLFEIKIHGLPKRKRRELETTLRDFAA
SLKDSPDASPSQRKNVSRHSTRDNMYSASGSASKHASSSSGSNARPVDSAYASMSTGAYSCGTSHNRPPMSSRVR
SSEQKVQNYLRDIPEGLYPRHMAMTDREKKRVVVRRLEQLFTGKIGGRHSKRGQLAPGIVAAANAAMDAPMAEGQ
SLHRQQLSQAPNLSGAEPAREAKIVLPDQQQHAAHGKKSTSRDNGSASHSNEDQTESGGNGNSSGSGANVSPSNV
PPLPEQRPTRPKDLDPDRVQVPSENMDYIRHLGLVPPELLADSVQAEPDVHPDAEGWVYLNLLCNLAQLHIINVT
PSFVRSAVSEMSTKFQLSPDGRKIRWRGGSEGTRFSSDSSRDASQKSPDTDDTTSSNKEESRKRQKTTGNSTGDD
FQSGGGSSTKNPSKFGPQVSASSESFHYKPLFVQQQSPNGQTSIDDTLSSFGPVEDSNVGGSRWELSGSGTSNRR
KRRRDGAIIYYSGAPFCTDLSGEPGDVSPATYMRSGAGQDRPALVPRFVRPLPHRSASGSSLCYRPLCDGPGPED
DSNKMTSETDAVPGLTSDSDSSSSDVEMDVGWSDKQQLMEIRPLEPCGLGGVLPDDHFLVVVTTRRMTKEPAAQT
AAVSRPNVDETTEGIISRLASMSTSSPVPVTSSSSSRCASPAIEIEYMSGRIKRLRPVSLPPPAIFFPPFSTDSS
SDGDSDAGFDGDDDEYGSSEESRSRKANPHQSDGYPDGVDLTSGDEDGEDPDNEPDSRCMYDVDAGDQDAEDDTH
RSMGSADVAPGTARGIVGGIAAGEVRNVAVIGAGAAGSSAAYHLSRYAQQRNIVLNTTIFERTDRIGGRTLTTNA
FNDASQPVELGASIFVTVNHILINASRAFNLVVADVDSPAVRGDLTLIWDGEDVVFRDVAGQGSWMWEMVRLWWR
YGLAPFRAMGLIKGVRVVELGLGAIAGVTGEQYLVDNKIDSEFARHLMQPATRVNYASNLAYIHGVEAMVSLATE
KAVEIEGGNWQIFDHMVRSSGAALCRNTTVTAIDLGEKKDKYTLSTGDTNSAYPVAFDDVIIATPWQFSGIKAAT
GVLQTEIDEVPYMKLHVTLFASPLTLRPEYFGLEEGDGPPRNVYTTLGRDEVPGLGAEGVGRTGFYSVSTLRRVR
NPSTGATEYLYKVFSAEPVKPAFLAGILGVEVPDMFLAEGRAVSNSDVTMLDNLHVSAEFAGRDWRDAASRVPEC
QSKREPAFNTNFNHRYKMKYDAATLLLAAGTSLARPAVIRRDGLLPWKPMTNTCDATHTSEDHCGTDAFCEMYRF
GIKLNPAWNSWEECINAHESRHAEQPPPASSPPGWATKKPWTELTDDAKCRSSLERVEKFCGTERYCQSFKYTWG
RTKYKSERECLDHHEPAPKKPWSEPKNHASCAMGGATDEGLCGTKTYCRRFAHLTGTGHRYASEQECLDAHEPEP
AGSNLPANDKPSGQPKKPWLRPGAAGPCGASMGTSEVHCGTKVYCEQFKYPGGDNRYGSEQECLNDHEPETAGNG
APAGSQSQANDKPASRVKKAWLQPGAPGPCSESMGTNERHCGTKIYCVQFNYAGGNHRQYGSERECLDDHEPETA
GNGAPAGSQSQANDKPASRVKKAWLQPGMPGPCSQSMGTNERHCGTKIYCEQFNYAGGSHRQYGSERECLDDHVP
EPAGKGAPTSSKPPTGGNPQADNKPPSYGKKPWLQPLNPARCAQALGTDEAYCGTKFYCKTLNQRNVNSGYANER
ECLDDHEPEPVTNNPPEDRPPTIDYNPGKPKKPWVELKNLNLCQDWDGRNEHWCGTEIFCRSFNNPMGSEPAYGS
EQECLNDHTTPRKTESQPTQWRIAFPDN*
Coding >Ophcf2|05194
ATGTGCTGGCCGGATGACGAGGGCTCGTATACCGCCTTCCGATCGCCTCTGATCTCGACGTCCCCTGGTCATCGC
AGCCATCGGGGCGAAAAGGCCATCATCTTGCACCTCAAAAAAAAAATTTCCCTGGCTGGGAAACCCCTGGCCTCC
CGTTGTCCGCCAGCGCAACCGTCATCGTCGGGCACCAGACACTCTTACGTCACCGAACCTCCTGTCCGACTTATA
CCGCCCGCTCATCGTCATGCTCGTTTGGCCCGCTTACACCTCCAAACTTGTCTGTTGAATGAGTTCACCATTATG
CCATTCACCGAGCGTCCCTCCCATGGCACGCAACCGCCACCTCCTTTCCCGACCGGCCATCCCCTTCCTCGCCGC
GCGTCTCCTGCCAACTCCATTACCCTCCGACATCACAGACTGGCCCGCGATGCGTCGCTCCGAGCGAGTCCTGGG
TCCGGCACCCAGAAGAACAAGATGATGGCTTCATCGCCGAGGCGAAACTCGTCCGGCGACAGCCACGTCACCGGC
CAGAGCGATCCCAAAAAGTGGTTCGACTTATCCAACCAGAACCCGACGGCGACTTTTGACAACAACATCATGGAC
GTCGACCCTCCTTTCTTCCAAAAGGAATCCGACTCTTCCAACGAAGAGAAAGCATATCCCTATCCGAACCCGGCT
GTTCCCCCGAGGCTGGCCGTTGCTCAGAGCAGCAGTGCCGATGACTATCGCAGCGTCATCGATGACCTGACCGTT
GAGATTCAGAAGCTGAAGGAGCAGCTGAAACGCTACAAACAGTCCGGTCCCGACATGATGCGCAAGGACAAGCTG
TTCGAGATTAAGATCCACGGCCTGCCGAAACGGAAGAGGCGCGAGTTGGAGACGACTCTTCGCGATTTCGCCGCG
AGCCTCAAAGACTCGCCTGATGCGTCTCCGTCGCAGCGGAAAAACGTGTCGAGACATTCGACTCGCGATAACATG
TATTCGGCGTCGGGATCCGCGTCCAAGCACGCTTCGTCATCGTCCGGCTCCAACGCCCGTCCGGTCGACTCTGCC
TACGCCTCCATGTCGACGGGTGCCTACTCGTGCGGCACGTCTCATAACCGTCCGCCCATGAGCTCCAGAGTACGG
TCGTCGGAACAAAAGGTACAGAATTATCTTCGTGATATTCCGGAGGGACTATATCCTCGCCACATGGCCATGACG
GACCGGGAGAAGAAGAGAGTCGTGGTCCGTCGTCTCGAGCAGCTCTTTACTGGCAAGATTGGCGGCCGACATTCC
AAACGAGGCCAGCTGGCTCCCGGTATTGTTGCAGCCGCCAACGCTGCCATGGACGCCCCGATGGCCGAGGGACAG
TCTCTTCACCGCCAGCAGTTGTCGCAGGCGCCCAACCTCTCCGGTGCCGAACCCGCCCGTGAGGCGAAGATCGTT
CTGCCAGATCAGCAGCAGCACGCGGCGCACGGCAAGAAGAGCACGTCCAGGGATAACGGGTCCGCGTCTCACTCC
AACGAAGATCAGACGGAATCGGGAGGGAATGGTAACAGCAGCGGATCCGGGGCCAATGTCTCGCCATCTAACGTG
CCGCCTCTTCCCGAGCAGCGGCCCACCCGACCCAAGGATCTCGATCCCGACCGTGTCCAGGTCCCTTCTGAGAAC
ATGGACTACATACGTCACTTGGGCCTTGTGCCGCCCGAGTTGCTGGCCGACTCGGTCCAAGCCGAGCCCGACGTG
CACCCCGACGCCGAGGGATGGGTGTACCTCAACTTACTGTGCAACTTGGCCCAGCTGCACATCATCAACGTCACG
CCGAGTTTCGTCCGTTCGGCCGTGTCGGAGATGAGCACAAAATTTCAGTTGTCACCTGACGGCCGCAAGATTCGC
TGGCGAGGCGGGTCCGAGGGCACCAGGTTCTCCAGCGACAGTTCCAGGGACGCGTCGCAGAAGAGCCCCGATACG
GACGACACGACAAGCTCCAATAAGGAGGAGTCGCGAAAGCGTCAGAAGACGACGGGCAACTCGACCGGCGACGAC
TTTCAGTCGGGCGGAGGAAGCTCCACCAAGAATCCGTCCAAGTTTGGGCCGCAGGTGTCGGCCTCGTCCGAGAGC
TTCCATTACAAGCCGCTATTTGTACAGCAGCAGTCGCCCAACGGTCAGACGTCTATCGACGACACTCTGTCGTCG
TTTGGCCCCGTCGAGGACAGCAACGTCGGCGGTTCGCGATGGGAACTCAGCGGCTCCGGCACGTCCAACCGTCGG
AAGCGCCGTCGCGACGGCGCCATCATCTACTACAGCGGCGCGCCCTTCTGTACCGATCTTTCGGGGGAGCCCGGC
GACGTGTCGCCGGCGACGTATATGCGATCCGGAGCCGGCCAGGACCGTCCGGCGCTAGTCCCGCGATTCGTGCGC
CCGCTTCCGCACCGGTCCGCCTCCGGGTCCTCGTTGTGCTACCGCCCGCTCTGTGACGGGCCGGGTCCGGAAGAT
GACTCCAACAAGATGACGAGCGAGACCGACGCCGTGCCGGGTCTCACGTCGGACTCGGATTCGTCCTCGAGCGAC
GTGGAGATGGACGTCGGATGGTCCGACAAGCAGCAGTTGATGGAGATTCGACCGCTGGAGCCGTGCGGACTGGGC
GGTGTGCTGCCCGACGATCACTTCCTGGTTGTTGTCACGACGAGGAGGATGACGAAGGAGCCCGCGGCGCAGACG
GCGGCTGTGAGCCGACCCAACGTCGACGAGACCACGGAGGGCATCATCAGCCGGTTAGCCTCCATGTCGACTTCT
TCGCCGGTCCCCGTGACGTCCAGTTCGTCTTCCCGGTGCGCCTCGCCGGCCATCGAGATCGAGTACATGTCAGGA
CGGATCAAGCGGCTGAGACCCGTATCGCTACCGCCACCGGCCATCTTCTTTCCGCCCTTTAGCACCGATTCGTCG
TCCGACGGAGACAGCGATGCCGGTTTCGACGGTGACGACGACGAGTACGGGTCGTCTGAGGAGTCGAGAAGCCGC
AAGGCCAACCCGCATCAGTCGGACGGGTATCCCGACGGCGTGGACCTCACCAGCGGCGACGAGGACGGCGAGGAC
CCGGACAACGAGCCGGATTCACGCTGCATGTACGACGTCGATGCGGGTGACCAGGATGCTGAAGATGACACGCAT
CGATCCATGGGCAGCGCCGACGTGGCGCCGGGAACAGCCCGGGGGATCGTGGGGGGAATCGCGGCTGGCGAGGTG
AGGAACGTGGCTGTTATTGGTGCCGGGGCAGCGGGCTCATCAGCGGCCTATCACCTCTCCCGTTACGCCCAGCAG
CGCAACATTGTCCTCAACACGACAATCTTTGAAAGAACGGACCGGATCGGCGGCCGAACCCTCACGACAAACGCC
TTCAACGACGCCTCGCAGCCCGTCGAGCTGGGAGCTTCCATCTTCGTAACCGTAAATCACATCCTCATCAACGCG
AGCCGGGCCTTTAACCTCGTCGTCGCTGACGTTGACTCCCCGGCTGTACGTGGTGATCTCACTCTCATATGGGAT
GGTGAGGACGTTGTCTTTCGCGATGTTGCCGGTCAAGGATCGTGGATGTGGGAGATGGTGAGGTTGTGGTGGCGA
TATGGATTGGCGCCTTTTCGGGCCATGGGGTTGATCAAGGGGGTTAGGGTTGTTGAGTTGGGGCTGGGGGCGATT
GCGGGCGTTACGGGGGAGCAGTATCTTGTCGACAACAAGATTGATTCCGAGTTTGCGCGTCATCTGATGCAGCCG
GCCACGCGCGTCAACTACGCCTCTAACCTGGCTTACATCCACGGCGTTGAAGCCATGGTCTCGCTCGCGACGGAA
AAGGCCGTTGAGATTGAAGGTGGGAACTGGCAGATCTTCGACCACATGGTTCGCAGCAGCGGGGCGGCTCTCTGT
CGAAACACGACCGTCACGGCCATTGACTTGGGCGAGAAGAAGGACAAGTACACGCTCTCGACGGGGGACACGAAC
TCTGCGTACCCCGTTGCCTTTGACGACGTCATCATCGCGACGCCCTGGCAGTTCAGCGGTATCAAGGCGGCGACG
GGCGTGCTGCAGACTGAGATTGATGAGGTGCCGTACATGAAACTTCACGTTACGCTCTTCGCGTCGCCTCTTACC
TTGCGGCCCGAGTACTTTGGTCTCGAGGAGGGTGACGGGCCGCCGAGGAATGTTTATACGACGCTTGGGAGGGAT
GAGGTGCCGGGGTTGGGGGCCGAAGGTGTTGGGCGGACGGGGTTCTACTCCGTGAGTACGCTTCGGAGGGTGAGG
AACCCATCTACAGGTGCGACGGAGTACCTTTACAAGGTTTTCAGCGCCGAGCCCGTGAAGCCGGCGTTCCTGGCT
GGCATATTGGGCGTCGAGGTTCCGGACATGTTCCTGGCTGAGGGGCGTGCCGTCTCCAATTCCGATGTGACGATG
CTGGATAATCTACACGTTTCCGCAGAGTTCGCTGGGCGGGACTGGCGTGATGCTGCGTCGCGAGTTCCGGAGTGT
CAATCAAAGAGAGAGCCAGCCTTCAACACCAACTTCAACCATCGCTACAAGATGAAGTACGACGCTGCTACCCTC
CTCCTCGCCGCGGGCACCTCCCTGGCCCGTCCGGCCGTGATCCGTCGCGACGGTCTCCTCCCGTGGAAACCCATG
ACAAACACCTGCGACGCCACTCACACCAGCGAGGACCACTGCGGCACCGACGCCTTTTGCGAAATGTATCGCTTC
GGCATCAAGTTGAATCCGGCTTGGAATAGCTGGGAAGAGTGCATCAATGCTCACGAGTCGCGGCATGCCGAACAG
CCGCCGCCTGCGTCATCGCCACCGGGATGGGCGACGAAGAAGCCGTGGACGGAGCTGACGGATGATGCCAAGTGC
CGTTCTTCCCTGGAGAGGGTCGAGAAGTTTTGCGGAACGGAGCGGTACTGTCAGTCGTTCAAGTACACGTGGGGA
CGCACCAAGTACAAGAGCGAGAGGGAGTGTCTGGATCATCACGAGCCGGCGCCGAAGAAACCATGGTCAGAACCC
AAGAATCACGCCTCTTGTGCCATGGGCGGTGCAACGGATGAAGGGCTCTGCGGCACAAAGACCTACTGTCGACGC
TTTGCCCATCTGACTGGAACTGGTCATCGGTACGCAAGCGAGCAGGAGTGCCTGGACGCTCACGAACCGGAACCA
GCTGGCAGCAACCTTCCAGCCAACGACAAGCCTTCTGGTCAACCCAAGAAACCGTGGCTGCGACCGGGGGCGGCC
GGGCCTTGTGGCGCGAGCATGGGAACGAGCGAGGTGCATTGCGGAACGAAGGTCTACTGCGAACAATTCAAGTAT
CCGGGCGGAGATAATCGGTACGGGAGCGAGCAGGAGTGCCTGAACGATCACGAACCGGAAACGGCCGGGAACGGC
GCCCCGGCCGGCAGCCAGTCCCAGGCCAACGACAAGCCTGCAAGCCGAGTCAAGAAAGCCTGGTTACAGCCGGGA
GCGCCCGGGCCTTGCAGCGAGAGCATGGGAACAAACGAGAGGCACTGCGGCACCAAGATCTACTGCGTACAGTTC
AACTATGCCGGCGGAAACCATCGTCAGTACGGGAGCGAGCGGGAGTGTCTGGACGATCACGAGCCGGAAACGGCC
GGGAACGGCGCCCCGGCCGGCAGCCAGTCCCAGGCCAATGACAAGCCTGCAAGCCGAGTCAAGAAAGCCTGGTTA
CAACCGGGAATGCCCGGCCCTTGCAGCCAGAGCATGGGAACAAACGAGAGGCATTGCGGCACCAAGATATACTGC
GAACAGTTCAACTATGCTGGCGGAAGCCATCGTCAGTACGGGAGCGAGCGGGAGTGTCTGGACGACCACGTGCCG
GAACCGGCTGGCAAGGGTGCTCCGACAAGCAGCAAACCCCCGACTGGCGGCAACCCCCAGGCCGACAACAAGCCT
CCAAGCTACGGAAAGAAGCCATGGTTGCAGCCGCTGAACCCAGCCCGTTGCGCTCAAGCTTTGGGGACCGACGAG
GCGTACTGCGGCACCAAGTTCTACTGCAAAACCCTCAACCAACGAAACGTAAATTCCGGGTACGCGAACGAGAGG
GAGTGCCTGGATGATCACGAGCCGGAGCCGGTCACCAACAACCCCCCCGAAGACAGGCCCCCCACCATCGATTAT
AACCCGGGAAAGCCCAAGAAGCCCTGGGTGGAGCTTAAGAACCTCAATCTTTGTCAAGACTGGGATGGAAGGAAT
GAGCATTGGTGTGGCACCGAGATCTTCTGCCGGAGCTTCAACAATCCCATGGGAAGCGAGCCTGCGTATGGCAGT
GAACAGGAGTGCCTGAACGACCATACGACGCCGCGGAAGACTGAGTCTCAGCCTACGCAGTGGCGGATTGCTTTC
CCGGATAATTAA
Transcript >Ophcf2|05194
ATGTGCTGGCCGGATGACGAGGGCTCGTATACCGCCTTCCGATCGCCTCTGATCTCGACGTCCCCTGGTCATCGC
AGCCATCGGGGCGAAAAGGCCATCATCTTGCACCTCAAAAAAAAAATTTCCCTGGCTGGGAAACCCCTGGCCTCC
CGTTGTCCGCCAGCGCAACCGTCATCGTCGGGCACCAGACACTCTTACGTCACCGAACCTCCTGTCCGACTTATA
CCGCCCGCTCATCGTCATGCTCGTTTGGCCCGCTTACACCTCCAAACTTGTCTGTTGAATGAGTTCACCATTATG
CCATTCACCGAGCGTCCCTCCCATGGCACGCAACCGCCACCTCCTTTCCCGACCGGCCATCCCCTTCCTCGCCGC
GCGTCTCCTGCCAACTCCATTACCCTCCGACATCACAGACTGGCCCGCGATGCGTCGCTCCGAGCGAGTCCTGGG
TCCGGCACCCAGAAGAACAAGATGATGGCTTCATCGCCGAGGCGAAACTCGTCCGGCGACAGCCACGTCACCGGC
CAGAGCGATCCCAAAAAGTGGTTCGACTTATCCAACCAGAACCCGACGGCGACTTTTGACAACAACATCATGGAC
GTCGACCCTCCTTTCTTCCAAAAGGAATCCGACTCTTCCAACGAAGAGAAAGCATATCCCTATCCGAACCCGGCT
GTTCCCCCGAGGCTGGCCGTTGCTCAGAGCAGCAGTGCCGATGACTATCGCAGCGTCATCGATGACCTGACCGTT
GAGATTCAGAAGCTGAAGGAGCAGCTGAAACGCTACAAACAGTCCGGTCCCGACATGATGCGCAAGGACAAGCTG
TTCGAGATTAAGATCCACGGCCTGCCGAAACGGAAGAGGCGCGAGTTGGAGACGACTCTTCGCGATTTCGCCGCG
AGCCTCAAAGACTCGCCTGATGCGTCTCCGTCGCAGCGGAAAAACGTGTCGAGACATTCGACTCGCGATAACATG
TATTCGGCGTCGGGATCCGCGTCCAAGCACGCTTCGTCATCGTCCGGCTCCAACGCCCGTCCGGTCGACTCTGCC
TACGCCTCCATGTCGACGGGTGCCTACTCGTGCGGCACGTCTCATAACCGTCCGCCCATGAGCTCCAGAGTACGG
TCGTCGGAACAAAAGGTACAGAATTATCTTCGTGATATTCCGGAGGGACTATATCCTCGCCACATGGCCATGACG
GACCGGGAGAAGAAGAGAGTCGTGGTCCGTCGTCTCGAGCAGCTCTTTACTGGCAAGATTGGCGGCCGACATTCC
AAACGAGGCCAGCTGGCTCCCGGTATTGTTGCAGCCGCCAACGCTGCCATGGACGCCCCGATGGCCGAGGGACAG
TCTCTTCACCGCCAGCAGTTGTCGCAGGCGCCCAACCTCTCCGGTGCCGAACCCGCCCGTGAGGCGAAGATCGTT
CTGCCAGATCAGCAGCAGCACGCGGCGCACGGCAAGAAGAGCACGTCCAGGGATAACGGGTCCGCGTCTCACTCC
AACGAAGATCAGACGGAATCGGGAGGGAATGGTAACAGCAGCGGATCCGGGGCCAATGTCTCGCCATCTAACGTG
CCGCCTCTTCCCGAGCAGCGGCCCACCCGACCCAAGGATCTCGATCCCGACCGTGTCCAGGTCCCTTCTGAGAAC
ATGGACTACATACGTCACTTGGGCCTTGTGCCGCCCGAGTTGCTGGCCGACTCGGTCCAAGCCGAGCCCGACGTG
CACCCCGACGCCGAGGGATGGGTGTACCTCAACTTACTGTGCAACTTGGCCCAGCTGCACATCATCAACGTCACG
CCGAGTTTCGTCCGTTCGGCCGTGTCGGAGATGAGCACAAAATTTCAGTTGTCACCTGACGGCCGCAAGATTCGC
TGGCGAGGCGGGTCCGAGGGCACCAGGTTCTCCAGCGACAGTTCCAGGGACGCGTCGCAGAAGAGCCCCGATACG
GACGACACGACAAGCTCCAATAAGGAGGAGTCGCGAAAGCGTCAGAAGACGACGGGCAACTCGACCGGCGACGAC
TTTCAGTCGGGCGGAGGAAGCTCCACCAAGAATCCGTCCAAGTTTGGGCCGCAGGTGTCGGCCTCGTCCGAGAGC
TTCCATTACAAGCCGCTATTTGTACAGCAGCAGTCGCCCAACGGTCAGACGTCTATCGACGACACTCTGTCGTCG
TTTGGCCCCGTCGAGGACAGCAACGTCGGCGGTTCGCGATGGGAACTCAGCGGCTCCGGCACGTCCAACCGTCGG
AAGCGCCGTCGCGACGGCGCCATCATCTACTACAGCGGCGCGCCCTTCTGTACCGATCTTTCGGGGGAGCCCGGC
GACGTGTCGCCGGCGACGTATATGCGATCCGGAGCCGGCCAGGACCGTCCGGCGCTAGTCCCGCGATTCGTGCGC
CCGCTTCCGCACCGGTCCGCCTCCGGGTCCTCGTTGTGCTACCGCCCGCTCTGTGACGGGCCGGGTCCGGAAGAT
GACTCCAACAAGATGACGAGCGAGACCGACGCCGTGCCGGGTCTCACGTCGGACTCGGATTCGTCCTCGAGCGAC
GTGGAGATGGACGTCGGATGGTCCGACAAGCAGCAGTTGATGGAGATTCGACCGCTGGAGCCGTGCGGACTGGGC
GGTGTGCTGCCCGACGATCACTTCCTGGTTGTTGTCACGACGAGGAGGATGACGAAGGAGCCCGCGGCGCAGACG
GCGGCTGTGAGCCGACCCAACGTCGACGAGACCACGGAGGGCATCATCAGCCGGTTAGCCTCCATGTCGACTTCT
TCGCCGGTCCCCGTGACGTCCAGTTCGTCTTCCCGGTGCGCCTCGCCGGCCATCGAGATCGAGTACATGTCAGGA
CGGATCAAGCGGCTGAGACCCGTATCGCTACCGCCACCGGCCATCTTCTTTCCGCCCTTTAGCACCGATTCGTCG
TCCGACGGAGACAGCGATGCCGGTTTCGACGGTGACGACGACGAGTACGGGTCGTCTGAGGAGTCGAGAAGCCGC
AAGGCCAACCCGCATCAGTCGGACGGGTATCCCGACGGCGTGGACCTCACCAGCGGCGACGAGGACGGCGAGGAC
CCGGACAACGAGCCGGATTCACGCTGCATGTACGACGTCGATGCGGGTGACCAGGATGCTGAAGATGACACGCAT
CGATCCATGGGCAGCGCCGACGTGGCGCCGGGAACAGCCCGGGGGATCGTGGGGGGAATCGCGGCTGGCGAGGTG
AGGAACGTGGCTGTTATTGGTGCCGGGGCAGCGGGCTCATCAGCGGCCTATCACCTCTCCCGTTACGCCCAGCAG
CGCAACATTGTCCTCAACACGACAATCTTTGAAAGAACGGACCGGATCGGCGGCCGAACCCTCACGACAAACGCC
TTCAACGACGCCTCGCAGCCCGTCGAGCTGGGAGCTTCCATCTTCGTAACCGTAAATCACATCCTCATCAACGCG
AGCCGGGCCTTTAACCTCGTCGTCGCTGACGTTGACTCCCCGGCTGTACGTGGTGATCTCACTCTCATATGGGAT
GGTGAGGACGTTGTCTTTCGCGATGTTGCCGGTCAAGGATCGTGGATGTGGGAGATGGTGAGGTTGTGGTGGCGA
TATGGATTGGCGCCTTTTCGGGCCATGGGGTTGATCAAGGGGGTTAGGGTTGTTGAGTTGGGGCTGGGGGCGATT
GCGGGCGTTACGGGGGAGCAGTATCTTGTCGACAACAAGATTGATTCCGAGTTTGCGCGTCATCTGATGCAGCCG
GCCACGCGCGTCAACTACGCCTCTAACCTGGCTTACATCCACGGCGTTGAAGCCATGGTCTCGCTCGCGACGGAA
AAGGCCGTTGAGATTGAAGGTGGGAACTGGCAGATCTTCGACCACATGGTTCGCAGCAGCGGGGCGGCTCTCTGT
CGAAACACGACCGTCACGGCCATTGACTTGGGCGAGAAGAAGGACAAGTACACGCTCTCGACGGGGGACACGAAC
TCTGCGTACCCCGTTGCCTTTGACGACGTCATCATCGCGACGCCCTGGCAGTTCAGCGGTATCAAGGCGGCGACG
GGCGTGCTGCAGACTGAGATTGATGAGGTGCCGTACATGAAACTTCACGTTACGCTCTTCGCGTCGCCTCTTACC
TTGCGGCCCGAGTACTTTGGTCTCGAGGAGGGTGACGGGCCGCCGAGGAATGTTTATACGACGCTTGGGAGGGAT
GAGGTGCCGGGGTTGGGGGCCGAAGGTGTTGGGCGGACGGGGTTCTACTCCGTGAGTACGCTTCGGAGGGTGAGG
AACCCATCTACAGGTGCGACGGAGTACCTTTACAAGGTTTTCAGCGCCGAGCCCGTGAAGCCGGCGTTCCTGGCT
GGCATATTGGGCGTCGAGGTTCCGGACATGTTCCTGGCTGAGGGGCGTGCCGTCTCCAATTCCGATGTGACGATG
CTGGATAATCTACACGTTTCCGCAGAGTTCGCTGGGCGGGACTGGCGTGATGCTGCGTCGCGAGTTCCGGAGTGT
CAATCAAAGAGAGAGCCAGCCTTCAACACCAACTTCAACCATCGCTACAAGATGAAGTACGACGCTGCTACCCTC
CTCCTCGCCGCGGGCACCTCCCTGGCCCGTCCGGCCGTGATCCGTCGCGACGGTCTCCTCCCGTGGAAACCCATG
ACAAACACCTGCGACGCCACTCACACCAGCGAGGACCACTGCGGCACCGACGCCTTTTGCGAAATGTATCGCTTC
GGCATCAAGTTGAATCCGGCTTGGAATAGCTGGGAAGAGTGCATCAATGCTCACGAGTCGCGGCATGCCGAACAG
CCGCCGCCTGCGTCATCGCCACCGGGATGGGCGACGAAGAAGCCGTGGACGGAGCTGACGGATGATGCCAAGTGC
CGTTCTTCCCTGGAGAGGGTCGAGAAGTTTTGCGGAACGGAGCGGTACTGTCAGTCGTTCAAGTACACGTGGGGA
CGCACCAAGTACAAGAGCGAGAGGGAGTGTCTGGATCATCACGAGCCGGCGCCGAAGAAACCATGGTCAGAACCC
AAGAATCACGCCTCTTGTGCCATGGGCGGTGCAACGGATGAAGGGCTCTGCGGCACAAAGACCTACTGTCGACGC
TTTGCCCATCTGACTGGAACTGGTCATCGGTACGCAAGCGAGCAGGAGTGCCTGGACGCTCACGAACCGGAACCA
GCTGGCAGCAACCTTCCAGCCAACGACAAGCCTTCTGGTCAACCCAAGAAACCGTGGCTGCGACCGGGGGCGGCC
GGGCCTTGTGGCGCGAGCATGGGAACGAGCGAGGTGCATTGCGGAACGAAGGTCTACTGCGAACAATTCAAGTAT
CCGGGCGGAGATAATCGGTACGGGAGCGAGCAGGAGTGCCTGAACGATCACGAACCGGAAACGGCCGGGAACGGC
GCCCCGGCCGGCAGCCAGTCCCAGGCCAACGACAAGCCTGCAAGCCGAGTCAAGAAAGCCTGGTTACAGCCGGGA
GCGCCCGGGCCTTGCAGCGAGAGCATGGGAACAAACGAGAGGCACTGCGGCACCAAGATCTACTGCGTACAGTTC
AACTATGCCGGCGGAAACCATCGTCAGTACGGGAGCGAGCGGGAGTGTCTGGACGATCACGAGCCGGAAACGGCC
GGGAACGGCGCCCCGGCCGGCAGCCAGTCCCAGGCCAATGACAAGCCTGCAAGCCGAGTCAAGAAAGCCTGGTTA
CAACCGGGAATGCCCGGCCCTTGCAGCCAGAGCATGGGAACAAACGAGAGGCATTGCGGCACCAAGATATACTGC
GAACAGTTCAACTATGCTGGCGGAAGCCATCGTCAGTACGGGAGCGAGCGGGAGTGTCTGGACGACCACGTGCCG
GAACCGGCTGGCAAGGGTGCTCCGACAAGCAGCAAACCCCCGACTGGCGGCAACCCCCAGGCCGACAACAAGCCT
CCAAGCTACGGAAAGAAGCCATGGTTGCAGCCGCTGAACCCAGCCCGTTGCGCTCAAGCTTTGGGGACCGACGAG
GCGTACTGCGGCACCAAGTTCTACTGCAAAACCCTCAACCAACGAAACGTAAATTCCGGGTACGCGAACGAGAGG
GAGTGCCTGGATGATCACGAGCCGGAGCCGGTCACCAACAACCCCCCCGAAGACAGGCCCCCCACCATCGATTAT
AACCCGGGAAAGCCCAAGAAGCCCTGGGTGGAGCTTAAGAACCTCAATCTTTGTCAAGACTGGGATGGAAGGAAT
GAGCATTGGTGTGGCACCGAGATCTTCTGCCGGAGCTTCAACAATCCCATGGGAAGCGAGCCTGCGTATGGCAGT
GAACAGGAGTGCCTGAACGACCATACGACGCCGCGGAAGACTGAGTCTCAGCCTACGCAGTGGCGGATTGCTTTC
CCGGATAATTAA
Gene >Ophcf2|05194
ATGTGCTGGCCGGATGACGAGGGCTCGTATACCGTCCATTCCGTACACCCGGGCGTCGACGCAGCAGACAAGCCC
TGAATCTAGGCCTTCCGATCGCCTCTGATCTCGACGTCCCCTGGTCATCGCAGCCATCGGGGCGAAAAGGCCATC
ATCTTGCACCTCGTGCGTTACATCTTTTAATATTTTTTATTTTAATATTTTTTACCCGCCTTAGTCTGTCTTTCA
TTCTTTTCCCCCTTCTCCACTGCAGCTCATCAGAGATCTCGCTGGTCGCAGGCCCTTTCCATCGTCATCCCCATC
CCGCCGCTGCCGAGAGTTTTTTTTTTCGTCACATTCTGCTTCATCTTCTTCTTACCTCGACACGCCACACACCCC
TCTTCGTCGTCCTCCTCCTCCATCTCGTCCTCCTCCCCTCCTCTTCTTACAGACTGCCTTTCTTGTCGCTGGCTG
CTGGCTGCTTCCACATCACGCGATATCCTCTTGGTAAGTGACAGCTCTCCACGATGAAAGCTGCGCCCTCCGTGT
CGGGGGACCCCCCATTGGGATGCCCTCATTTCCGACCCGCTGCTCCCTTTTGCGCCCGCAATTGCCTGACCGTGT
CCATCTTGTCCCGCTCGAGTTTACATTTCTTATTTCCGGGCCTCGCCTGTTTCCCCTCTCTCCCTCTCTCCTGTT
TCCCCGCTTCTCACGGGGATAGAAAGCTCGACCGTGGCTGTGATATGTTGAGTCTGACTCGCTCCTCTTCTTTTT
AGACGGCTTCGAACTCGATCTCTCCGAAGACTACATACATACATACATACATACATACTCCATACATACAACTCA
CTGCTGTCGACCTCGGAGGCAGAAAATATTCCTCCCCTCCGACGAATCCCTCCGCATCTGCTCTTCGTCCGCCGT
CTCCGCACTGCCTGTGGGCTCGGCGTCGTACTTTTGCGCCCTCTGTCGATTGTTCGCCTGGTCCAGACCTTGTCC
GACGATTTGGCGACGTCGAAGGCTCGAGAAGACAAGCCCAGAGAAATCACACCACCCCGACATTAGGCCTCGTAA
CTCGGCTGCGAGCCCATCCCCTCGTCTCTCGCCGTCCACCCACCAAACCTCGCGAGGTCGAACCGCCAACCTCCT
CCCGTCTGCGAACCCGCCGTTTCGATACCGTTGCGAGACACCTTTGACCGGCTGAATTACTGCTGAAAAGAAAAA
AAAAATTTCCCTGGCTGGGAAACCCCTGGTCAGTCACAGAACCCCGTCGAGAGCCCTTTTCGATCGATCTATCCC
CCCTCTCCCTCCTAGCCAATCATCATCCCCGTCGTCTCATCCTCCGCCGCCATGACATACATGCAATGATGAAGG
AGTGCGAGGGCCGTTGTTTTTCTTTCTATTGCACCAACCGCTTCAGCCGAGTCCGGCTAGGTTCCGATGCTGACA
TACCACTTCCCTGTTGAAGGCCTCCCGTTGTCCGCCAGCGCAACCGTCATCGTCGGGCACCAGACACTCTTACGT
CACCGAACCTCCTGTCCGACTTATACCGCCCGCTCATCGTCATGCTCGTTTGGCCCGCTTACACCTCCAAACTTG
TCTGTTGAATGAGTTCACCATTATGCCATTCACCGAGCGTCCCTCCCATGGCACGCAACCGCCACCTCCTTTCCC
GACCGGCCATCCCCTTCCTCGCCGCGCGTCTCCTGCCAACTCCATTACCCTCCGACATCACAGACTGGCCCGCGA
TGCGTCGCTCCGAGCGAGTCCTGGGTCCGGCACCCAGAAGAACAAGATGATGGCTTCATCGCCGAGGCGAAACTC
GTCCGGCGACAGCCACGTCACCGGCCAGAGCGATCCCAAAAAGTGGTTCGACTTATCCAACCAGAACCCGACGGC
GACTTTTGACAACAACATCATGGACGGTTCGTTGGCGTCATTCCGAGCCTGATGCACATCGAGACGCTGACTTGG
CAATGTGTAGTCGACCCTCCTTTCTTCCAAAAGGAATCCGACTCTTCCAACGAAGAGAAAGCATATCCCTATCCG
AACCCGGCTGTTCCCCCGAGGCTGGCCGTTGCTCAGAGCAGCAGTGCCGATGACTATCGCAGCGTCATCGATGAC
CTGACCGTTGAGATTCAGAAGCTGAAGGAGCAGCTGAAACGCTACAAACAGTCCGGTCCCGACATGATGCGCAAG
GACAAGCTGTTCGAGATTAAGATCCACGGCCTGCCGAAACGGAAGAGGCGCGAGTTGGAGACGACTCTTCGCGAT
TTCGCCGCGAGCCTCAAAGACTCGCCTGATGCGTCTCCGTCGCAGCGGAAAAACGTGTCGAGACATTCGACTCGC
GATAACATGTATTCGGCGTCGGGATCCGCGTCCAAGCACGCTTCGTCATCGTCCGGCTCCAACGCCCGTCCGGTC
GACTCTGCCTACGCCTCCATGTCGACGGGTGCCTACTCGTGCGGCACGTCTCATAACCGTCCGCCCATGAGCTCC
AGAGTACGGTCGTCGGAACAAAAGGTACAGAATTATCTTCGTGATATTCCGGAGGGACTATATCCTCGCCACATG
GCCATGACGGACCGGGAGAAGAAGAGAGTCGTGGTCCGTCGTCTCGAGCAGCTCTTTACTGGCAAGATTGGCGGC
CGACATTCCAAACGAGGCCAGCTGGCTCCCGGTATTGTTGCAGCCGCCAACGCTGCCATGGACGCCCCGATGGCC
GAGGGACAGTCTCTTCACCGCCAGCAGTTGTCGCAGGCGCCCAACCTCTCCGGTGCCGAACCCGCCCGTGAGGCG
AAGATCGTTCTGCCAGATCAGCAGCAGCACGCGGCGCACGGCAAGAAGAGCACGTCCAGGGATAACGGGTCCGCG
TCTCACTCCAACGAAGATCAGACGGAATCGGGAGGGAATGGTAACAGCAGCGGATCCGGGGCCAATGTCTCGCCA
TCTAACGTGCCGCCTCTTCCCGAGCAGCGGCCCACCCGACCCAAGGATCTCGATCCCGACCGTGTCCAGGTCCCT
TCTGAGAACATGGACTACATACGTCACTTGGGCCTTGTGCCGCCCGAGTTGCTGGCCGACTCGGTCCAAGCCGAG
CCCGACGTGCACCCCGACGCCGAGGGATGGGTGTACCTCAACTTACTGTGCAACTTGGCCCAGCTGCACATCATC
AACGTCACGCCGAGTTTCGTCCGTTCGGCCGTGTCGGAGATGAGCACAAAATTTCAGTTGTCACCTGACGGCCGC
AAGATTCGCTGGCGAGGCGGGTCCGAGGGCACCAGGTTCTCCAGCGACAGTTCCAGGGACGCGTCGCAGAAGAGC
CCCGATACGGACGACACGACAAGCTCCAATAAGGAGGAGTCGCGAAAGCGTCAGAAGACGACGGGCAACTCGACC
GGCGACGACTTTCAGTCGGGCGGAGGAAGCTCCACCAAGAATCCGTCCAAGTTTGGGCCGCAGGTGTCGGCCTCG
TCCGAGAGCTTCCATTACAAGCCGCTATTTGTACAGCAGCAGTCGCCCAACGGTCAGACGTCTATCGACGACACT
CTGTCGTCGTTTGGCCCCGTCGAGGACAGCAACGTCGGCGGTTCGCGATGGGAACTCAGCGGCTCCGGCACGTCC
AACCGTCGGAAGCGCCGTCGCGACGGCGCCATCATCTACTACAGCGGCGCGCCCTTCTGTACCGATCTTTCGGGG
GAGCCCGGCGACGTGTCGCCGGCGACGTATATGCGATCCGGAGCCGGCCAGGACCGTCCGGCGCTAGTCCCGCGA
TTCGTGCGCCCGCTTCCGCACCGGTCCGCCTCCGGGTCCTCGTTGTGCTACCGCCCGCTCTGTGACGGGCCGGGT
CCGGAAGATGACTCCAACAAGATGACGAGCGAGACCGACGCCGTGCCGGGTCTCACGTCGGACTCGGATTCGTCC
TCGAGCGACGTGGAGATGGACGTCGGATGGTCCGACAAGCAGCAGTTGATGGAGATTCGACCGCTGGAGCCGTGC
GGACTGGGCGGTGTGCTGCCCGACGATCACTTCCTGGTTGTTGTCACGACGAGGAGGATGACGAAGGAGCCCGCG
GCGCAGACGGCGGCTGTGAGCCGACCCAACGTCGACGAGACCACGGAGGGCATCATCAGCCGGTTAGCCTCCATG
TCGACTTCTTCGCCGGTCCCCGTGACGTCCAGTTCGTCTTCCCGGTGCGCCTCGCCGGCCATCGAGATCGAGTAC
ATGTCAGGACGGATCAAGCGGCTGAGACCCGTATCGCTACCGCCACCGGCCATCTTCTTTCCGCCCTTTAGCACC
GATTCGTCGTCCGACGGAGACAGCGATGCCGGTTTCGACGGTGACGACGACGAGTACGGGTCGTCTGAGGAGTCG
AGAAGCCGCAAGGCCAACCCGCATCAGTCGGACGGGTATCCCGACGGCGTGGACCTCACCAGCGGCGACGAGGAC
GGCGAGGACCCGGACAACGAGCCGGATTCACGCTGCATGTACGACGTCGATGCGGGTGACCAGGATGCTGAAGAT
GACACGCATCGATCCATGGGCAGCGCCGACGTGGCGCCGGGAACAGCCCGTGAACGCAGCAAGAGTGCAAGCGAG
ATGATGACTCGCACGGGTGGGAGCTCGGCTGCCACTGCTGGAGGGCCTGGAAGCAGGTGTCCCAGCAGCAACGAG
GAGCTGACTTTTACGATGTAATCCTCTGGATGTATTCACTTTGGGATATGACGAAAGGTGCATTTTCCAATCACG
GCGTTTGGGGGGAACGGGACCACCCGACGAGGACAGAATCGGGAATGGGGGATTCAATGGGAGCTGTGTGGAGTT
TGGGTTGTTGGTGTCAAGATTATATGATTCCCCTGGCGCGTGGTGCCTAGATGATGTTGACTTGACCAATTATTG
ATTGAATCAAAGTTTACTATGGAAACGATCCAGATGGTGAGGTGAGGGTAGAGAGAGGCGGAGCAAGTTATGGAG
ATTGAACAAAGGACTAGGAGGCCATTGTGGTTTCGAGTGTTGGTGTGAGTGTTGTTGGTGTTGGGTGTTTTGGGC
TTCGGTGGCCTCCGAGGTTGGCTGTGACTTCATACAGGTTGGGAGACGCTGTTTCACTCTTGCAAATGGGAGTAG
ATACGAGGATAGCAGTCAGTCCGTGCAAGAACGCCCGACGAACCTGCCTACCAGATCAGATCGAAAGATGAAGAT
GAACCGGACAGATGGAGGCCGAAAGGGTCGGGGGATGACGCAAGCCATGATGTAAAGATTGATCGGATCGAGGGC
TACATACTCCGGTACCTAAGTTAGTAGGCAGAGGTAGGCATGTATGTATGTACCTAGATACTTATTGGTGGTTAC
TGCCGGGAGGACACGCCATGACGTCAAAATGATGTTGGGCCGTGTAAATGGCGTTCTCATCACGTGCCAGTTGTT
GTGATTATCTCGTTTGTATCCGGACGACGTCTGTTTTGAGGACGAAGACAGAAACAACGACGTGACGTGACGAGA
TGCGCATGCAGACGGGATTCGCTCTTACCGGTGTCTTGGCAGGGGGGATCGTGGGGGGAATCGCGGCTGGCGAGG
TGAGGAACGTGGCTGTTATTGGTGAGTGGACGACGCCTGGCTCGGCCAAGACATGGATGGACCCTTGGAGTTGGC
TATCGAACAGGTTTCTGGCGACGGCGGTTGATTCCATGACTGACTTCTTCTCCAAGGTGCCGGGGCAGCGGGCTC
ATCAGCGGCCTATCACCTCTCCCGTTACGCCCAGCAGCGCAACATTGTCCTCAACACGACAATCTTTGAAAGAAC
GGACCGGATCGGCGGCCGAACCCTCACGACAAACGCCTTCAACGACGCCTCGCAGCCCGTCGAGCTGGGAGCTTC
CATCTTCGTAACCGTAAATCACATCCTCATCAACGCGAGCCGGGCCTTTAACCTCGTCGTCGCTGACGTTGACTC
CCCGGCTGTACGTGGTGATCTCACTCTCATATGGGATGGTGAGGACGTTGTCTTTCGCGATGTTGCCGGTCAAGG
ATCGTGGATGTGGGAGATGGTGAGGTTGTGGTGGCGATATGGATTGGCGCCTTTTCGGGCCATGGGGTTGATCAA
GGGGGTTGTGAGTAAGTTTCTGAGGTTGTATGATGAGCCGTTTTTCCCTTTTGTTTCGCTGTCTGAGAGGGTTGT
TGAGTTGGGGCTGGGGGCGATTGCGGGCGTTACGGGGGAGCAGTATCTTGTCGACAACAAGGTGGGTGTATCTTT
CCCTTTCTTTTCTTCTTTCTTTCTTTCTTTCTTCCTTCTAATCCTTGTCTCATCTTGGACAGATTGATTCCGAGT
TTGCGCGTCATCTGATGCAGCCGGCCACGCGCGTCAACTACGCCTCTAACCTGGCTTACATCCACGGCGTTGAAG
CCATGGTCTCGCTCGCGACGGAAAAGGCCGTTGAGATTGAAGGTGGGAACTGGCAGATCTTCGACCACATGGTTC
GCAGCAGCGGGGCGGCTCTCTGTCGAAACACGACCGTCACGGCCATTGACTTGGGCGAGAAGAAGGACAAGTACA
CGCTCTCGACGGGGGACACGAACTCTGCGTACCCCGTTGCCTTTGACGACGTCATCATCGCGACGCCCTGGCAGT
TCAGCGGTATCAAGGCGGCGACGGGCGTGCTGCAGACTGAGATTGATGAGGTGCCGTACATGAAACTTCACGTTA
CGCTCTTCGCGTCGCCTCTTACCTTGCGGCCCGAGTACTTTGGTCTCGAGGAGGGTGACGGGCCGCCGAGGAATG
TTTATACGACGCTTGGGAGGGATGAGGTGCCGGGGTTGGGGGCCGAAGGTGTTGGGCGGACGGGGTTCTACTCCG
TGAGTACGCTTCGGAGGGTGAGGAACCCATCTACAGGTGCGACGGAGTACCTTTACAAGGTTTTCAGCGCCGAGC
CCGTGAAGCCGGCGTTCCTGGCTGGCATATTGGGCGTCGAGGTTCCGGACATGTTCCTGGCTGAGGGGGTGGTTT
CGTGGTTCTATCCCACTTGGTTTCACTCGTATCCTGTTGTTTTGCCGCGGGTTACTTTTCAGGATCCCGGGGTGG
GGAGGGGAGTTTGGTATACTTCTGGGGTCGAGGGGTTTATATCGACCATGGAGACGAGTGCGTTGATGGGGATGA
ATGTTGCGAGGTTGATTGTTGGGGGGGAGGAGGATAGGGGGAAGGGGGGGCTAGAGTTGAGTTGTAGGGGTTGGG
GGTTGGATTTGGGGTTGGGGTTGGGGTTGGGGTTGAGGGTTGGATCTTTGTTTTTGTGTATTTGTATAGAGTTGT
CTGGTTAATGGATTTGATATGAATGTTGGTTTCTTTGTGGATGGGAGACATGAAACCAGGTTCAGAGGAGATGCA
ACGTCAGCTAGCAGAGCACCTACTCCCTTACATACAGACTCAATCGCTCAACTTTTCCACCGCAGAGGACTGTTC
GCCAGACAGCATAGACAAGGTCCCGCCCTGACTCTACATACGGTCTATAACACTTGATCTCACGCACATCGACCA
CCATCTCGACTCCCTCGCCAAGCTTCTTTGAGGCAGGCCGCAGCAATCGGCTCCCACAGGCTCGACAGCAGAGCA
ATGATAAATCATAGGTGTGTATGTATTTATGTTTGTATGTTGTATGTATGTACCGTCGCGGCTGACTCTGACGCG
TCCGACTCCGCTGCTGGGCGCAGTTCAGCTCTCGAGTCTCCCTGTTTGGCTTGGATGGTTCCTTGGCTTTCACAG
TTGTGATGGAATCCGACAGCCAGTCTATGATTATTGTATGTGTATGTGTGTATGTGTGTATGTATGTATGTATGT
ACATATGCATCTATCTATGTTCATTGCATGTGTATACACACATACATACATATTCTAGCCCATTGTCCCGCAATC
TCTAGCACTGCCTCTTCCCTCAACAGCGACCAATATTCATCCCTTGCAGCGTGCCGTCTCCAATTCCGATGTGAC
GATGCTGGATAATCTACACGTTTCCGCAGAGTTCGCTGGGCGGGACTGGCGTGATGCTGCGTCGCGAGTTCCGGA
GTGTCAATGTGCGAGTATGTATGTACATACATACATACATACATACATACGTAGCCGTCCTTGATAATCCAGTCT
ATATTGTATCCTATAATGGGCTCATGTGACTGGTTATCGGCAGGGCTTATGAGTCAGAGCCTATCCACTTTGTGG
CTTATTTGAAATTATAGGGTTGAGGCCGGCAAGGTTGGCTGGATAGTCGGACGACTTGCATGACGATCAATAGAC
TCTGCGCAACCCGGTCAACGGTGGTTTTGCCTTGATTAAGATGAAAGCAATGGATTTATTCGTAAGCTCGATCCT
GATGTACATACATACATACATGCACACTCTACCAGACTCCAATTATAGAAACAAGAGATTATGATCTAGGCTCTA
TATCGTGCACGCGTCTTGACTCAGGCATTCCGTCCAGGACGAACTGTGACCGGTAACGACGAAACTCTTCCGAGC
AGACTTTCAACGTCGAGGTAGGAGTATCTTCTCGCCGCCGCTGTGCACTGAGTTTCAATACCTTCGAGGCGTGAT
ACAAGGAGGGGGGAAGGCTAACCGTGTTGTCCTACGACGGACCTGCGGTGGGCATACACACATATATATATACAC
TCATACACATGTATGTACATATGTACTTGATTTCTAATCTTGTACAGACATGATGCTCGTCATTCTCCCGATGAT
GCCATCGTCTGCTTATCAGGTGGAGCGGTTGACGTGGCTGATATCAATGCCCCGGTGATATCGAGAAACAAACCT
TTTCAACTCTTGCGTGAACATGTGTGTGTGTGTGTATGTACATATGTACGCACGTAGTTGTAAGTAGGTATGTAC
ATACATACAGGCTCCCTCTCAGCTCCAAGTTTCTATAACGGGATGCCAAGCACATAAACACACACACACACACAT
ACATACATACATATACCTACCTACATACAGATATACACTTGTACGTAGTCCAACTGATGAAAGCTATAAAGCCAC
GGCTGCCCCCCCCCCCCAAATCCCGCCAGCAAAGAGAGAGCCAGCCTTCAACACCAACTTCAACCATCGCTACAA
GATGAAGTACGACGCTGCTACCCTCCTCCTCGCCGCGGGCACCTCCCTGGCCCGTCCGGCCGTGATCCGTCGCGA
CGGTCTCCTCCCGTGGAAACCCATGACAAACACCTGCGACGCCACTCACACCAGCGAGGACCACTGCGGCACCGA
CGCCTTTTGCGAAATGTATCGCTTCGGCATCAAGTTGAATCCGGCTTGGAATAGCTGGGAAGAGTGCATCAATGC
TCACGAGTCGCGGCATGCCGAACAGCCGCCGCCTGCGTCATCGCCACCGGGATGGGCGACGAAGAAGCCGTGGAC
GGAGCTGACGGATGATGCCAAGTGCCGTTCTTCCCTGGAGAGGGTCGAGAAGTTTTGCGGAACGGAGCGGTACTG
TCAGTCGTTCAAGTACACGTGGGGACGCACCAAGTACAAGAGCGAGAGGGAGTGTCTGGATCATCACGAGCCGGC
GCCGAAGAAACCATGGTCAGAACCCAAGAATCACGCCTCTTGTGCCATGGGCGGTGCAACGGATGAAGGGCTCTG
CGGCACAAAGACCTACTGTCGACGCTTTGCCCATCTGACTGGAACTGGTCATCGGTACGCAAGCGAGCAGGAGTG
CCTGGACGCTCACGAACCGGAACCAGCTGGCAGCAACCTTCCAGCCAACGACAAGCCTTCTGGTCAACCCAAGAA
ACCGTGGCTGCGACCGGGGGCGGCCGGGCCTTGTGGCGCGAGCATGGGAACGAGCGAGGTGCATTGCGGAACGAA
GGTCTACTGCGAACAATTCAAGTATCCGGGCGGAGATAATCGGTACGGGAGCGAGCAGGAGTGCCTGAACGATCA
CGAACCGGAAACGGCCGGGAACGGCGCCCCGGCCGGCAGCCAGTCCCAGGCCAACGACAAGCCTGCAAGCCGAGT
CAAGAAAGCCTGGTTACAGCCGGGAGCGCCCGGGCCTTGCAGCGAGAGCATGGGAACAAACGAGAGGCACTGCGG
CACCAAGATCTACTGCGTACAGTTCAACTATGCCGGCGGAAACCATCGTCAGTACGGGAGCGAGCGGGAGTGTCT
GGACGATCACGAGCCGGAAACGGCCGGGAACGGCGCCCCGGCCGGCAGCCAGTCCCAGGCCAATGACAAGCCTGC
AAGCCGAGTCAAGAAAGCCTGGTTACAACCGGGAATGCCCGGCCCTTGCAGCCAGAGCATGGGAACAAACGAGAG
GCATTGCGGCACCAAGATATACTGCGAACAGTTCAACTATGCTGGCGGAAGCCATCGTCAGTACGGGAGCGAGCG
GGAGTGTCTGGACGACCACGTGCCGGAACCGGCTGGCAAGGGTGCTCCGACAAGCAGCAAACCCCCGACTGGCGG
CAACCCCCAGGCCGACAACAAGCCTCCAAGCTACGGAAAGAAGCCATGGTTGCAGCCGCTGAACCCAGCCCGTTG
CGCTCAAGCTTTGGGGACCGACGAGGCGTACTGCGGCACCAAGTTCTACTGCAAAACCCTCAACCAACGAAACGT
AAATTCCGGGTACGCGAACGAGAGGGAGTGCCTGGATGATCACGAGCCGGAGCCGGTCACCAACAACCCCCCCGA
AGACAGGCCCCCCACCATCGATTATAACCCGGGAAAGCCCAAGAAGCCCTGGGTGGAGCTTAAGAACCTCAATCT
TTGTCAAGACTGGGATGGAAGGAATGAGCATTGGTGTGGCACCGAGATCTTCTGCCGGAGCTTCAACAATCCCAT
GGGAAGCGAGCCTGCGTATGGCAGTGAACAGGAGTGCCTGAACGACCATACGACGCCGCGGAAGACTGAGTCTCA
GCCTACGCAGTGGCGGATTGCTTTCCCGGATAATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail