Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05193
Gene name
Locationscaffold_05:2737868..2740364
Strand-
Gene length (bp)2496
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08553 VID27 VID27 C-terminal WD40-like domain 9.0E-185 438 794
PF17748 VID27_N VID27 N-terminal region 9.6E-72 1 176
PF17747 VID27_PH VID27 PH-like domain 2.5E-42 252 359

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4352 0.4736 0.289 0.0799 0.1076 0.0059 0.1065 0.271 0.1507 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2115
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2738
Ophiocordyceps australis map64 (Brazil) OphauB2|6591
Ophiocordyceps camponoti-floridani Ophcf2|05193 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3291
Ophiocordyceps kimflemingae Ophio5|6048
Ophiocordyceps subramaniannii Hirsu2|2517

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05193
MFVLRNVGKLIFGSSAQESLIDLPQGQLYLVRPLSPKGYSELIFKDAAVRIRRTNQDFQYQLVVQRVFEEGEAEL
LAEEEGEDAEIDALVAERDEKTFLLDEALHLRIDIRESGEKVLAWRDLSGDSGDLYEFVCDNHVPCSLVERFIQA
ARECQFERKYRRPHASAFPDDLRQFEFHEEPPIPPASPLHSPTLARSIDSVEDMYKHRTAANSSAKRGAASASEP
SSLPDGGEVPGPSTPPSKRQPPPQAIEIYATVTAELHLFDPQPGHFAMVDDEVIATVTEVGKWEYWLQVDGKDKS
WLGVPVVADFNPVFDFEYLSFVFNHFSDDGTARSWLLRFKDQPTLERFQQAIMQAIWEKLNETKWAKIKEKEREY
VLDAFGDLAMEDAPPSEEDAARAEEEEDEDEEEGDENAKGIHSQVYDSEDEEAAEEERKGGEVNSQLAVGYKHDR
SFVVRGSKIGVFSHTPDNRLKFSTNISKVTTPSGRLMSPKKVMLHSEDRDLIMQNEVDANKLFRMDIEYGKVVDE
WKVHDDIPVVTFAPENKFAQMTSEQTFLGVSGNALYRIDPRLSGNKLVDSDMKQYASKNDFSALATTEKGYVAVA
SNKGDIRLFDRLGIRAKTQLPALGDAITGMDVSADGRWILGTTKNYLLLVDAKQKDGKYEGRLGFEQPFSANSKP
QPRRLALSPEHVAQFYHETGKPVSFTPAKFNAGEGAEETSIITATGPYIVEWNLKRVLQGGAGPGKGHGAYRIKR
YEDDVKADDFKFGSDKNVIVALPNEVNMVAKRALRRPTRESIMGGARLSSGGGRASSSRHIGGVDSGRYKLGKED
IVNSPY*
Coding >Ophcf2|05193
ATGTTTGTCTTGCGAAACGTTGGCAAGCTGATTTTCGGCTCGAGCGCCCAGGAGTCGCTCATCGACCTGCCTCAG
GGCCAGCTGTACCTCGTCCGCCCGCTCTCGCCCAAGGGGTACTCTGAGCTCATCTTCAAGGACGCCGCCGTCCGC
ATTCGCCGCACCAACCAGGATTTTCAATACCAGCTCGTCGTCCAACGCGTCTTTGAGGAGGGCGAGGCCGAGCTG
CTCGCCGAAGAGGAGGGTGAGGACGCCGAGATCGACGCTCTAGTGGCCGAGCGTGACGAAAAGACGTTTCTTCTC
GACGAGGCCCTTCACCTTCGCATCGATATTCGCGAGAGCGGAGAAAAAGTGCTGGCCTGGAGAGACTTGAGCGGT
GACTCGGGCGACCTCTACGAGTTCGTTTGCGACAACCACGTTCCTTGTTCCCTCGTCGAGCGCTTCATACAAGCC
GCTCGCGAGTGTCAGTTTGAGCGCAAGTACCGCCGGCCACACGCAAGCGCCTTCCCCGACGACCTCCGTCAGTTC
GAGTTCCACGAGGAACCTCCGATCCCGCCTGCGAGCCCTCTTCACAGCCCGACGCTGGCCCGCTCCATAGATTCC
GTCGAAGATATGTACAAGCACAGGACCGCGGCCAACTCGTCGGCCAAGAGGGGCGCTGCCTCGGCGTCGGAGCCC
TCTTCGCTCCCCGACGGAGGCGAAGTGCCGGGCCCTTCTACGCCGCCTAGCAAGCGACAACCGCCTCCTCAGGCT
ATAGAGATCTACGCTACCGTCACCGCTGAGCTGCACCTTTTCGATCCGCAACCCGGTCACTTTGCCATGGTCGAC
GATGAGGTCATCGCTACCGTCACCGAGGTCGGCAAGTGGGAGTATTGGCTGCAGGTCGACGGCAAAGACAAGTCA
TGGCTGGGAGTGCCGGTCGTGGCAGATTTCAACCCCGTCTTCGACTTTGAATACCTGTCGTTCGTCTTCAACCAC
TTCAGCGATGACGGCACCGCGAGGTCGTGGCTCTTGCGTTTCAAAGACCAGCCGACATTGGAAAGGTTTCAGCAA
GCCATCATGCAGGCCATCTGGGAGAAGCTCAACGAGACGAAATGGGCCAAGATCAAGGAAAAAGAGCGCGAGTAT
GTCCTCGACGCGTTCGGAGACCTGGCCATGGAGGACGCGCCTCCATCGGAAGAGGACGCCGCCCGAGCCGAGGAA
GAGGAGGACGAGGACGAGGAAGAGGGGGACGAGAACGCCAAGGGCATCCACAGCCAGGTCTACGATTCGGAAGAC
GAGGAGGCGGCCGAGGAGGAGAGAAAGGGGGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACGACCGC
TCCTTTGTCGTCCGGGGCTCCAAGATTGGCGTCTTCTCGCACACGCCCGATAACCGACTCAAGTTCTCGACCAAC
ATTTCCAAGGTGACGACGCCCAGCGGGAGACTGATGAGCCCCAAGAAGGTGATGCTACACAGCGAGGACCGCGAC
CTCATCATGCAAAACGAAGTCGACGCCAACAAGCTCTTCCGGATGGACATTGAATACGGCAAGGTGGTGGACGAG
TGGAAGGTGCACGACGATATTCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCACAGATGACGTCGGAGCAG
ACGTTCCTGGGCGTCTCGGGCAACGCCTTGTACCGCATCGATCCGCGGTTATCGGGCAACAAGCTCGTCGATTCC
GACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCCACGACGGAAAAGGGTTACGTCGCCGTAGCC
AGCAACAAGGGCGACATCAGACTCTTTGACCGGCTCGGCATCCGGGCCAAGACGCAGCTGCCGGCTCTGGGCGAC
GCCATCACCGGCATGGACGTATCGGCCGACGGCCGTTGGATCCTCGGCACGACAAAGAACTACCTGCTTCTCGTC
GATGCCAAGCAAAAGGACGGCAAGTACGAGGGCAGGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCAAAGCCC
CAGCCGCGACGTCTGGCCCTCAGTCCCGAACACGTGGCCCAGTTCTACCACGAGACGGGTAAGCCGGTATCCTTC
ACGCCCGCCAAGTTCAACGCGGGAGAGGGGGCCGAGGAGACGAGCATCATCACGGCCACGGGCCCCTACATCGTC
GAATGGAACCTCAAGCGCGTCCTCCAGGGCGGCGCGGGCCCAGGAAAGGGCCACGGCGCGTACCGCATCAAGCGC
TACGAGGACGACGTCAAGGCAGACGACTTCAAGTTCGGGTCCGACAAGAACGTCATCGTCGCGCTGCCCAACGAG
GTCAACATGGTGGCCAAGCGGGCACTGCGGCGTCCGACGCGCGAGAGCATCATGGGCGGTGCCAGGCTCAGTTCC
GGAGGGGGGCGGGCCTCTTCTTCTCGCCATATCGGGGGGGTGGATAGTGGGAGGTATAAGCTCGGCAAGGAGGAT
ATCGTCAATTCTCCTTATTGA
Transcript >Ophcf2|05193
ATGTTTGTCTTGCGAAACGTTGGCAAGCTGATTTTCGGCTCGAGCGCCCAGGAGTCGCTCATCGACCTGCCTCAG
GGCCAGCTGTACCTCGTCCGCCCGCTCTCGCCCAAGGGGTACTCTGAGCTCATCTTCAAGGACGCCGCCGTCCGC
ATTCGCCGCACCAACCAGGATTTTCAATACCAGCTCGTCGTCCAACGCGTCTTTGAGGAGGGCGAGGCCGAGCTG
CTCGCCGAAGAGGAGGGTGAGGACGCCGAGATCGACGCTCTAGTGGCCGAGCGTGACGAAAAGACGTTTCTTCTC
GACGAGGCCCTTCACCTTCGCATCGATATTCGCGAGAGCGGAGAAAAAGTGCTGGCCTGGAGAGACTTGAGCGGT
GACTCGGGCGACCTCTACGAGTTCGTTTGCGACAACCACGTTCCTTGTTCCCTCGTCGAGCGCTTCATACAAGCC
GCTCGCGAGTGTCAGTTTGAGCGCAAGTACCGCCGGCCACACGCAAGCGCCTTCCCCGACGACCTCCGTCAGTTC
GAGTTCCACGAGGAACCTCCGATCCCGCCTGCGAGCCCTCTTCACAGCCCGACGCTGGCCCGCTCCATAGATTCC
GTCGAAGATATGTACAAGCACAGGACCGCGGCCAACTCGTCGGCCAAGAGGGGCGCTGCCTCGGCGTCGGAGCCC
TCTTCGCTCCCCGACGGAGGCGAAGTGCCGGGCCCTTCTACGCCGCCTAGCAAGCGACAACCGCCTCCTCAGGCT
ATAGAGATCTACGCTACCGTCACCGCTGAGCTGCACCTTTTCGATCCGCAACCCGGTCACTTTGCCATGGTCGAC
GATGAGGTCATCGCTACCGTCACCGAGGTCGGCAAGTGGGAGTATTGGCTGCAGGTCGACGGCAAAGACAAGTCA
TGGCTGGGAGTGCCGGTCGTGGCAGATTTCAACCCCGTCTTCGACTTTGAATACCTGTCGTTCGTCTTCAACCAC
TTCAGCGATGACGGCACCGCGAGGTCGTGGCTCTTGCGTTTCAAAGACCAGCCGACATTGGAAAGGTTTCAGCAA
GCCATCATGCAGGCCATCTGGGAGAAGCTCAACGAGACGAAATGGGCCAAGATCAAGGAAAAAGAGCGCGAGTAT
GTCCTCGACGCGTTCGGAGACCTGGCCATGGAGGACGCGCCTCCATCGGAAGAGGACGCCGCCCGAGCCGAGGAA
GAGGAGGACGAGGACGAGGAAGAGGGGGACGAGAACGCCAAGGGCATCCACAGCCAGGTCTACGATTCGGAAGAC
GAGGAGGCGGCCGAGGAGGAGAGAAAGGGGGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACGACCGC
TCCTTTGTCGTCCGGGGCTCCAAGATTGGCGTCTTCTCGCACACGCCCGATAACCGACTCAAGTTCTCGACCAAC
ATTTCCAAGGTGACGACGCCCAGCGGGAGACTGATGAGCCCCAAGAAGGTGATGCTACACAGCGAGGACCGCGAC
CTCATCATGCAAAACGAAGTCGACGCCAACAAGCTCTTCCGGATGGACATTGAATACGGCAAGGTGGTGGACGAG
TGGAAGGTGCACGACGATATTCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCACAGATGACGTCGGAGCAG
ACGTTCCTGGGCGTCTCGGGCAACGCCTTGTACCGCATCGATCCGCGGTTATCGGGCAACAAGCTCGTCGATTCC
GACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCCACGACGGAAAAGGGTTACGTCGCCGTAGCC
AGCAACAAGGGCGACATCAGACTCTTTGACCGGCTCGGCATCCGGGCCAAGACGCAGCTGCCGGCTCTGGGCGAC
GCCATCACCGGCATGGACGTATCGGCCGACGGCCGTTGGATCCTCGGCACGACAAAGAACTACCTGCTTCTCGTC
GATGCCAAGCAAAAGGACGGCAAGTACGAGGGCAGGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCAAAGCCC
CAGCCGCGACGTCTGGCCCTCAGTCCCGAACACGTGGCCCAGTTCTACCACGAGACGGGTAAGCCGGTATCCTTC
ACGCCCGCCAAGTTCAACGCGGGAGAGGGGGCCGAGGAGACGAGCATCATCACGGCCACGGGCCCCTACATCGTC
GAATGGAACCTCAAGCGCGTCCTCCAGGGCGGCGCGGGCCCAGGAAAGGGCCACGGCGCGTACCGCATCAAGCGC
TACGAGGACGACGTCAAGGCAGACGACTTCAAGTTCGGGTCCGACAAGAACGTCATCGTCGCGCTGCCCAACGAG
GTCAACATGGTGGCCAAGCGGGCACTGCGGCGTCCGACGCGCGAGAGCATCATGGGCGGTGCCAGGCTCAGTTCC
GGAGGGGGGCGGGCCTCTTCTTCTCGCCATATCGGGGGGGTGGATAGTGGGAGGTATAAGCTCGGCAAGGAGGAT
ATCGTCAATTCTCCTTATTGA
Gene >Ophcf2|05193
ATGTTTGTCTTGCGAAACGTTGGCAAGCTGATTTTCGGCTCGAGCGCCCAGGAGTCGCTCATCGACCTGCCTCAG
GGCCAGCTGTACCTCGTCCGCCCGCTCTCGCCCAAGGGGTACTCTGAGCTCATCTTCAAGGACGCCGCCGTCCGC
ATTCGCCGCACCAACCAGGATTTTCAATACCAGCTCGTCGTCCAACGCGTCTTTGAGGAGGGCGAGGCCGAGCTG
CTCGCCGAAGAGGAGGGTGAGGACGCCGAGATCGACGCTCTAGTGGCCGAGCGTGACGAAAAGACGTTTCTTCTC
GACGAGGCCCTTCACCTTCGCATCGATATTCGCGAGAGCGGAGAAAAAGTGCTGGCCTGGAGAGACTTGAGCGGT
GACTCGGGCGACCTCTACGAGTTCGTTTGCGACAACCACGTTCCTTGTTCCCTCGTCGAGCGCTTCATACAAGCC
GCTCGCGAGTGTCAGTTTGAGCGCAAGTACCGCCGGCCACACGCAAGCGCCTTCCCCGACGACCTCCGTCAGTTC
GAGTTCCACGAGGAACCTCCGATCCCGCCTGCGAGCCCTCTTCACAGCCCGACGCTGGCCCGCTCCATAGATTCC
GTCGAAGATATGTACAAGCACAGGACCGCGGCCAACTCGTCGGCCAAGAGGGGCGCTGCCTCGGCGTCGGAGCCC
TCTTCGCTCCCCGACGGAGGCGAAGTGCCGGGCCCTTCTACGCCGCCTAGCAAGCGACAACCGCCTCCTCAGGCT
ATAGAGATCTACGCTACCGTCACCGCTGAGCTGCACCTTTTCGATCCGCAACCCGGTCACTTTGCCATGGTCGAC
GATGAGGTCATCGCTACCGTCACCGAGGTCGGCAAGTGGGAGTATTGGCTGCAGGTCGACGGCAAAGACAAGTCA
TGGCTGGGAGTGCCGGTCGTGGCAGATTTCAACCCCGTCTTCGACTTTGAATACCTGTCGTTCGTCTTCAACCAC
TTCAGCGATGACGGCACCGCGAGGTCGTGGCTCTTGCGTTTCAAAGACCAGCCGACATTGGAAAGGTTTCAGCAA
GCCATCATGCAGGCCATCTGGGAGAAGCTCAACGAGACGAAATGGGCCAAGATCAAGGAAAAAGAGCGCGAGTAT
GTCCTCGACGCGTTCGGAGACCTGGCCATGGAGGACGCGCCTCCATCGGAAGAGGACGCCGCCCGAGCCGAGGAA
GAGGAGGACGAGGACGAGGAAGAGGGGGACGAGAACGCCAAGGGCATCCACAGCCAGGTCTACGATTCGGAAGAC
GAGGAGGCGGCCGAGGAGGAGAGAAAGGGGGGCGAAGTCAACTCGCAGCTGGCCGTCGGCTACAAGCACGACCGC
TCCTTTGTCGTCCGGGGCTCCAAGATTGGCGTCTTCTCGCACACGCCCGATAACCGACTCAAGTTCTCGACCAAC
ATTTCCAAGGTGACGACGCCCAGCGGGAGACTGATGAGCCCCAAGAAGGTGATGCTACACAGCGAGGACCGCGAC
CTCATCATGCAAAACGAAGTCGACGCCAACAAGCTCTTCCGGATGGACATTGAATACGGCAAGGTGGTGGACGAG
TGGAAGGTGCACGACGATATTCCCGTCGTCACGTTTGCGCCCGAGAACAAGTTTGCACAGATGACGTCGGAGCAG
ACGTTCCTGGGCGTCTCGGGCAACGCCTTGTACCGCATCGATCCGCGGTTATCGGGCAACAAGCTCGTCGATTCC
GACATGAAGCAGTACGCGTCCAAGAACGACTTCTCGGCCCTGGCCACGACGGAAAAGGGTTACGTCGCCGTAGCC
AGCAACAAGGGCGACATCAGACTCTTTGACCGGCTCGGCATCCGGGCCAAGACGCAGCTGCCGGCTCTGGGCGAC
GCCATCACCGGCATGGACGTATCGGCCGACGGCCGTTGGATCCTCGGCACGACAAAGAACTACCTGCTTCTCGTC
GATGCCAAGCAAAAGGACGGCAAGTACGAGGGCAGGCTCGGCTTCGAGCAGCCCTTTTCGGCCAACTCAAAGCCC
CAGCCGCGACGTCTGGCCCTCAGTCCCGAACACGTGGCCCAGTTCTACCACGAGACGGGTAAGCCGGTATCCTTC
ACGCCCGCCAAGTTCAACGCGGGAGAGGGGGCCGAGGAGACGAGCATCATCACGGCCACGGGCCCCTACATCGTC
GAATGGAACCTCAAGCGCGTCCTCCAGGGCGGCGCGGGCCCAGGAAAGGGCCACGGCGCGTACCGCATCAAGCGC
TACGAGGACGACGTCAAGGCAGACGACTTCAAGTTCGGGTCCGACAAGAACGTCATCGTCGCGCTGCCCAACGAG
GTCAACATGGTGGCCAAGCGGGCACTGCGGCGTCCGACGCGCGAGAGCATCATGGGCGGTGCCAGGCTCAGTTCC
GGAGGGGGGCGGGCCTCTTCTTCTCGCCATATCGGGGGGGTGGATAGTGGGAGGTATAAGCTCGGCAAGGAGGAT
ATCGTCAATTCTCCTTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail