Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05188
Gene name
Locationscaffold_05:2725881..2728599
Strand-
Gene length (bp)2718
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 5.0E-43 230 397
PF08066 PMC2NT PMC2NT (NUC016) domain 3.5E-24 19 117
PF00570 HRDC HRDC domain 8.7E-11 457 504

GO

GO Term Description Terminal node
GO:0000176 nuclear exosome (RNase complex) Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006396 RNA processing Yes
GO:0003676 nucleic acid binding Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:1905354 exoribonuclease complex No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0090304 nucleic acid metabolic process No
GO:0000178 exosome (RNase complex) No
GO:0004527 exonuclease activity No
GO:0008150 biological_process No
GO:0004518 nuclease activity No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3047 0.8355 0.117 0.0077 0.0952 0.0172 0.0569 0.0064 0.044 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4151
Ophiocordyceps australis map64 (Brazil) OphauB2|6589
Ophiocordyceps camponoti-floridani Ophcf2|05188 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3296
Ophiocordyceps kimflemingae Ophio5|3716
Ophiocordyceps subramaniannii Hirsu2|2520

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05188
MEDAPDFESQQKRIQKSLVSTVKTVNRLAAEDLQFQRTVNPDTARQLDESASRALDLSTRLLQAAARACKVQVKG
KAKEQAPKIEDVDDIDLKWSSIVDVVDSVLEKADTALDEFTGLIKRREPPPGEQTPTSRKSTGKVIRNADVSKPQ
LLFEKKQDNFPTEPWKPILTTKPHAILSLSQSLVLSPREDGTLQYKHPYEHEITNMQYPDRLFEIVEPIPYQPVE
STSATWVDTYDGVLDMLAELKKADEIAVDLEHHDFRTYTGLVCLMQISTREKDWIVDTLQPWRHKLEILNEVFAD
PKIIKVFHGAYMDMVWLQRDLGLYVNGLFDTFFASNILNFPSRSLAFLLSKFVDFSADKQYQLADWRIRPIPPEM
MYYARSDTHYLLYIFDHLRNELCKSDLSNSGAGYTRDALERSRELALSRHEHPEFDKETGRGSRGWYNYVLKQAH
LGFDSQQFAVFRAMWEWRDAVAREEDENPNFVLGTNQILSIVRVNPPDVKALHGMLPYTASLARARFVEMWERIR
DAKAQGGPSLLKFFSSQTSDVARKPAAKAATVEKTPVTSEQGDAKVASLKQSQLFGDMAISTRWEAGSHEFNGTE
DSLPFPWQRFVEGSAETGDGGADEKTSEEAQTENTGDIETAQAKGTDGMEAVQEVEDTAAETTAEVASKVADDDK
DDEVILKRGKKRKSKAVEDKEVSSAEQSGEKSGMDEADDGVLCMDEDEEPSDSKRASKKQRQKEHEEKAQKAHKK
TQRREERRSRKVKKRQQRQQQANEAPFDYSKAASVLHAGQGSTRERAKVFDPYAKTADEGLKGARKAPPVRGERS
ATFKG*
Coding >Ophcf2|05188
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAAAGGATTCAAAAGTCACTCGTCTCGACGGTCAAGACGGTA
AATCGCCTCGCCGCAGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTTGACGAAAGC
GCCTCTCGCGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCCCGCGCGTGCAAGGTCCAGGTGAAGGGA
AAGGCGAAGGAGCAGGCGCCCAAGATTGAGGATGTCGATGACATCGATCTCAAGTGGTCGTCCATCGTCGACGTT
GTCGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGACGAGTTTACGGGCTTGATCAAGCGCAGGGAACCCCCG
CCAGGGGAACAGACACCGACTTCGAGGAAATCCACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAG
CTGCTGTTCGAGAAGAAGCAGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTCACGACGAAGCCGCATGCC
ATTTTATCTCTATCCCAGAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAATACAAGCATCCTTACGAG
CATGAGATAACCAACATGCAATACCCAGACCGATTGTTCGAGATTGTCGAGCCGATTCCGTATCAGCCAGTCGAA
TCGACATCGGCCACATGGGTAGATACGTACGACGGCGTCTTGGACATGCTGGCGGAGCTAAAAAAGGCGGACGAA
ATAGCCGTTGACCTGGAGCACCACGACTTTCGCACCTACACTGGCCTCGTTTGCTTGATGCAGATCAGCACGCGC
GAAAAAGACTGGATAGTCGACACGCTGCAGCCCTGGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGAT
CCAAAGATCATCAAGGTCTTCCACGGTGCCTACATGGATATGGTGTGGTTGCAGCGAGACCTTGGCCTATACGTC
AACGGTCTCTTCGATACCTTTTTTGCCAGCAACATACTGAACTTCCCCAGCAGAAGCCTTGCCTTTCTCTTGTCC
AAGTTTGTCGACTTCAGCGCGGACAAGCAGTATCAGCTAGCCGACTGGAGGATACGGCCGATTCCTCCGGAGATG
ATGTATTACGCCCGATCCGATACCCATTACCTCTTGTACATATTCGATCACCTACGAAATGAGCTCTGCAAGAGC
GATCTCAGCAATTCGGGCGCCGGCTACACTAGAGATGCTCTTGAACGATCCAGGGAGCTGGCGCTGTCTCGCCAC
GAACACCCCGAATTCGACAAGGAGACGGGCAGGGGCTCGCGCGGCTGGTACAACTACGTCCTGAAGCAGGCCCAC
CTCGGATTCGACAGCCAGCAATTTGCTGTCTTCCGGGCCATGTGGGAGTGGAGGGATGCCGTGGCCCGTGAAGAA
GACGAAAACCCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCCCCGGACGTCAAG
GCCCTGCATGGCATGCTCCCGTACACGGCTTCCCTGGCCAGAGCCCGGTTCGTGGAAATGTGGGAACGGATCCGG
GACGCCAAGGCGCAAGGCGGACCGTCGCTGCTCAAGTTCTTTTCTTCTCAGACTTCGGATGTGGCGCGGAAACCA
GCAGCAAAAGCTGCGACTGTGGAAAAAACGCCGGTGACGTCGGAGCAGGGCGACGCCAAGGTCGCGAGTTTGAAG
CAATCACAGCTGTTTGGAGACATGGCGATAAGCACGCGTTGGGAAGCCGGGAGTCATGAATTCAATGGCACCGAA
GACAGCTTACCCTTTCCATGGCAGCGGTTCGTGGAGGGCTCAGCCGAGACAGGCGACGGGGGTGCGGATGAGAAG
ACTTCAGAGGAGGCCCAAACGGAGAATACCGGTGACATTGAGACGGCACAAGCGAAGGGTACCGATGGCATGGAG
GCGGTGCAAGAGGTCGAGGACACTGCCGCCGAGACGACAGCCGAGGTGGCATCCAAGGTGGCAGATGACGACAAG
GACGACGAGGTTATACTGAAGAGAGGAAAGAAACGGAAGTCAAAAGCGGTCGAAGACAAGGAAGTGTCGAGCGCA
GAGCAGTCAGGGGAGAAGAGCGGAATGGACGAGGCGGACGACGGAGTGCTGTGCATGGACGAAGATGAAGAGCCC
TCCGACAGCAAGAGGGCGTCGAAGAAGCAACGACAAAAGGAACACGAGGAAAAGGCCCAAAAGGCCCATAAGAAG
ACGCAGAGGCGAGAAGAACGCAGGTCAAGGAAGGTCAAGAAGAGGCAACAGAGGCAGCAGCAAGCCAACGAGGCT
CCGTTCGACTACAGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCGACTCGTGAGCGGGCCAAGGTGTTT
GATCCGTACGCGAAGACGGCGGACGAGGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTTCGGGGGGAGAGGAGC
GCGACGTTTAAGGGGTAG
Transcript >Ophcf2|05188
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAAAGGATTCAAAAGTCACTCGTCTCGACGGTCAAGACGGTA
AATCGCCTCGCCGCAGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTTGACGAAAGC
GCCTCTCGCGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCCCGCGCGTGCAAGGTCCAGGTGAAGGGA
AAGGCGAAGGAGCAGGCGCCCAAGATTGAGGATGTCGATGACATCGATCTCAAGTGGTCGTCCATCGTCGACGTT
GTCGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGACGAGTTTACGGGCTTGATCAAGCGCAGGGAACCCCCG
CCAGGGGAACAGACACCGACTTCGAGGAAATCCACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAG
CTGCTGTTCGAGAAGAAGCAGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTCACGACGAAGCCGCATGCC
ATTTTATCTCTATCCCAGAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAATACAAGCATCCTTACGAG
CATGAGATAACCAACATGCAATACCCAGACCGATTGTTCGAGATTGTCGAGCCGATTCCGTATCAGCCAGTCGAA
TCGACATCGGCCACATGGGTAGATACGTACGACGGCGTCTTGGACATGCTGGCGGAGCTAAAAAAGGCGGACGAA
ATAGCCGTTGACCTGGAGCACCACGACTTTCGCACCTACACTGGCCTCGTTTGCTTGATGCAGATCAGCACGCGC
GAAAAAGACTGGATAGTCGACACGCTGCAGCCCTGGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGAT
CCAAAGATCATCAAGGTCTTCCACGGTGCCTACATGGATATGGTGTGGTTGCAGCGAGACCTTGGCCTATACGTC
AACGGTCTCTTCGATACCTTTTTTGCCAGCAACATACTGAACTTCCCCAGCAGAAGCCTTGCCTTTCTCTTGTCC
AAGTTTGTCGACTTCAGCGCGGACAAGCAGTATCAGCTAGCCGACTGGAGGATACGGCCGATTCCTCCGGAGATG
ATGTATTACGCCCGATCCGATACCCATTACCTCTTGTACATATTCGATCACCTACGAAATGAGCTCTGCAAGAGC
GATCTCAGCAATTCGGGCGCCGGCTACACTAGAGATGCTCTTGAACGATCCAGGGAGCTGGCGCTGTCTCGCCAC
GAACACCCCGAATTCGACAAGGAGACGGGCAGGGGCTCGCGCGGCTGGTACAACTACGTCCTGAAGCAGGCCCAC
CTCGGATTCGACAGCCAGCAATTTGCTGTCTTCCGGGCCATGTGGGAGTGGAGGGATGCCGTGGCCCGTGAAGAA
GACGAAAACCCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCCCCGGACGTCAAG
GCCCTGCATGGCATGCTCCCGTACACGGCTTCCCTGGCCAGAGCCCGGTTCGTGGAAATGTGGGAACGGATCCGG
GACGCCAAGGCGCAAGGCGGACCGTCGCTGCTCAAGTTCTTTTCTTCTCAGACTTCGGATGTGGCGCGGAAACCA
GCAGCAAAAGCTGCGACTGTGGAAAAAACGCCGGTGACGTCGGAGCAGGGCGACGCCAAGGTCGCGAGTTTGAAG
CAATCACAGCTGTTTGGAGACATGGCGATAAGCACGCGTTGGGAAGCCGGGAGTCATGAATTCAATGGCACCGAA
GACAGCTTACCCTTTCCATGGCAGCGGTTCGTGGAGGGCTCAGCCGAGACAGGCGACGGGGGTGCGGATGAGAAG
ACTTCAGAGGAGGCCCAAACGGAGAATACCGGTGACATTGAGACGGCACAAGCGAAGGGTACCGATGGCATGGAG
GCGGTGCAAGAGGTCGAGGACACTGCCGCCGAGACGACAGCCGAGGTGGCATCCAAGGTGGCAGATGACGACAAG
GACGACGAGGTTATACTGAAGAGAGGAAAGAAACGGAAGTCAAAAGCGGTCGAAGACAAGGAAGTGTCGAGCGCA
GAGCAGTCAGGGGAGAAGAGCGGAATGGACGAGGCGGACGACGGAGTGCTGTGCATGGACGAAGATGAAGAGCCC
TCCGACAGCAAGAGGGCGTCGAAGAAGCAACGACAAAAGGAACACGAGGAAAAGGCCCAAAAGGCCCATAAGAAG
ACGCAGAGGCGAGAAGAACGCAGGTCAAGGAAGGTCAAGAAGAGGCAACAGAGGCAGCAGCAAGCCAACGAGGCT
CCGTTCGACTACAGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCGACTCGTGAGCGGGCCAAGGTGTTT
GATCCGTACGCGAAGACGGCGGACGAGGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTTCGGGGGGAGAGGAGC
GCGACGTTTAAGGGGTAG
Gene >Ophcf2|05188
ATGGAAGACGCTCCGGACTTCGAGTCCCAGCAGAAAAGGATTCAAAAGTCACTCGTCTCGACGGTCAAGACGGTA
AATCGCCTCGCCGCAGAGGACCTGCAGTTTCAGCGGACCGTCAACCCGGACACGGCTCGCCAGCTTGACGAAAGC
GCCTCTCGCGCCCTGGACTTGTCGACGCGCCTGCTGCAGGCCGCGGCCCGCGCGTGCAAGGTCCAGGTGAAGGGA
AAGGCGAAGGAGCAGGCGCCCAAGATTGAGGATGTCGATGACATCGATCTCAAGTGGTCGTCCATCGTCGACGTT
GTCGATTCAGTCTTGGAAAAGGCAGACACGGCGCTTGACGAGTTTACGGGCTTGATCAAGCGCAGGGAACCCCCG
CCAGGGGAACAGGTTGGCACTCATACCCCCATCCCCGAGATTCGCGGTCTTTCTGACATGGTCGTTGCAGACACC
GACTTCGAGGAAATCCACAGGCAAGGTCATCCGGAACGCCGACGTCTCCAAGCCGCAGCTGCTGTTCGAGAAGAA
GCAGGACAACTTTCCCACCGAGCCCTGGAAACCGATTCTCACGACGAAGCCGCATGCCATTTTATCTCTATCCCA
GAGCCTTGTCCTGTCCCCGCGAGAAGACGGCACACTTCAGTGGGTCCAACAGTCCTGATCTGCGCGCAAGAGAAT
CTCAGCTGACAACGGAAATCCCAGATACAAGCATCCTTACGAGCATGAGATAACCAACATGCAATACCCAGACCG
ATTGTTCGAGATTGTCGAGCCGATTCCGTATCAGCCAGTCGAATCGACATCGGCCACATGGGTAGATACGTACGA
CGGCGTCTTGGACATGCTGGCGGAGCTAAAAAAGGCGGACGAAATAGCCGTTGACCTGGAGCACCACGACTTTCG
CACCTACACTGGCCTCGTTTGCTTGATGCAGATCAGCACGCGCGAAAAAGACTGGATAGTCGACACGCTGCAGCC
CTGGCGTCACAAACTCGAGATTCTCAACGAGGTCTTTGCCGATCCAAAGATCATCAAGGTGAGTTTTACCTCGAC
GGCATCGGAAGCAGCCTCAACCGTCTGACAGTCGCTCGCTAGGTCTTCCACGGTGCCTACATGGATATGGTGTGG
TTGCAGCGAGACCTTGGCCTATACGTCAACGGTCTCTTCGATACCTTTTTTGCCAGCAACATACTGAACTTCCCC
AGCAGAAGCCTTGCCTTTCTCTTGTCCAAGTTTGTCGACTTCAGCGCGGACAAGCAGTATCAGCTAGCCGACTGG
AGGATACGGTTCGTGTCCTTGCCCAAAGACAGCGTGTCTCAGCTAACGTGTGCTAGGCCGATTCCTCCGGAGATG
ATGTATTACGCCCGATCCGATACCCATTACCTCTTGTACATATTCGATCACCTACGAAATGAGCTCTGCAAGAGC
GATCTCAGCAATTCGGGCGCCGGCTACACTAGAGATGCTCTTGAACGATCCAGGGAGCTGGCGCTGTCTCGCCAC
GAACACCCCGAATTCGACAAGGAGACGGGCAGGGGCTCGCGCGGCTGGTACAACTACGTCCTGAAGCAGGCCCAC
CTCGGATTCGACAGCCAGCAATTTGCTGTCTTCCGGGCCATGTGGGAGTGGAGGGATGCCGTGGCCCGTGAAGAA
GACGAAAACCCCAACTTTGTGCTGGGGACGAACCAGATACTCAGCATCGTGCGCGTCAACCCCCCGGACGTCAAG
GCCCTGCATGGCATGCTCCCGTACACGGCTTCCCTGGCCAGAGCCCGGTTCGTGGAAATGTGGGAACGGATCCGG
GACGCCAAGGCGCAAGGCGGACCGTCGCTGCTCAAGTTCTTTTCTTCTCAGACTTCGGATGTGGCGCGGAAACCA
GCAGCAAAAGCTGCGACTGTGGAAAAAACGCCGGTGACGTCGGAGCAGGGCGACGCCAAGGTCGCGAGTTTGAAG
CAATCACAGCTGTTTGGAGACATGGCGATAAGCACGCGTTGGGAAGCCGGGAGTCATGAATTCAATGGCACCGAA
GACAGCTTACCCTTTCCATGGCAGCGGTTCGTGGAGGGCTCAGCCGAGACAGGCGACGGGGGTGCGGATGAGAAG
ACTTCAGAGGAGGCCCAAACGGAGAATACCGGTGACATTGAGACGGCACAAGCGAAGGGTACCGATGGCATGGAG
GCGGTGCAAGAGGTCGAGGACACTGCCGCCGAGACGACAGCCGAGGTGGCATCCAAGGTGGCAGATGACGACAAG
GACGACGAGGTTATACTGAAGAGAGGAAAGAAACGGAAGTCAAAAGCGGTCGAAGACAAGGAAGTGTCGAGCGCA
GAGCAGTCAGGGGAGAAGAGCGGAATGGACGAGGCGGACGACGGAGTGCTGTGCATGGACGAAGATGAAGAGCCC
TCCGACAGCAAGAGGGCGTCGAAGAAGCAACGACAAAAGGAACACGAGGAAAAGGCCCAAAAGGCCCATAAGAAG
ACGCAGAGGCGAGAAGAACGCAGGTCAAGGAAGGTCAAGAAGAGGCAACAGAGGCAGCAGCAAGCCAACGAGGCT
CCGTTCGACTACAGCAAGGCGGCGTCGGTGCTTCACGCGGGCCAGGGCTCGACTCGTGAGCGGGCCAAGGTGTTT
GATCCGTACGCGAAGACGGCGGACGAGGGGCTCAAGGGGGCTCGCAAGGCGCCGCCTGTTCGGGGGGAGAGGAGC
GCGACGTTTAAGGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail