Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05169
Gene name
Locationscaffold_05:2682350..2683976
Strand+
Gene length (bp)1626
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04678 MCU Mitochondrial calcium uniporter 9.4E-25 294 417

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 331 353 22
2 363 382 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 65.45 37.59 93.32
Alive In ants, during behavior modification 23.96 11.80 36.12
Dead In ants, recently dead 19.90 9.61 30.20

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.372404 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05169
MHVTATAQLSTLLPPIVGRRNNDIPTTQCEKEAVARHRAMSSLLRRPAARLTAVTTLKRQPITRRGLASRPQEDQ
ANSNQEWQRLTTSKSQQRKVNDRPWQREGSNSLPKATSPDPSGGDLTKGRLLTTPTRLLKLILPMPFHPEQEHIN
ASDEEKKKWSGRAVEPLALLVHPQQPLSYLERLIQAEIPPMRTDGREKLPELVFRAEAETESSKSSSGDKDEKGG
DDDGVNVAAYSGLGREGPGKSSDKARWVRWSSSTEVGDFIRDAARGREFAIGIEGLDRELRVAVPSFKDRTYYLR
TRLRKMSRQIDQMSRVKKGCDLAAHQGANRLAKGGFAALAGWWGIVYYVTFHTEMGWDMVEPVTYLAGLTTIMAG
YLWFLFISRDLSYKAAMNLTVSRRQTALYQERGFDPHKWEQLVHEANLLRREVKMAATEYDVEWDEMRDLGGEEV
LEVLEEERGDRKRRGGKGAEEEGEEEEEEEDGERGGKTKE*
Coding >Ophcf2|05169
ATGCACGTGACTGCAACGGCACAGCTCAGCACGCTTCTACCACCCATCGTAGGAAGACGCAACAACGACATCCCG
ACCACGCAGTGCGAGAAAGAGGCCGTGGCGAGGCACCGCGCCATGAGCAGTCTCCTGAGACGGCCAGCAGCTCGT
CTCACCGCAGTAACGACGCTCAAACGACAACCCATCACCAGACGAGGCCTGGCATCGCGCCCGCAAGAAGATCAA
GCAAACAGCAACCAAGAATGGCAGCGCCTAACGACCAGCAAAAGCCAGCAAAGAAAAGTCAATGACCGTCCATGG
CAGCGCGAGGGAAGCAACTCCCTTCCCAAGGCCACATCGCCTGACCCGTCCGGCGGTGACTTGACAAAAGGGAGA
CTGTTGACGACGCCCACGCGGCTTCTCAAGCTCATCCTCCCTATGCCCTTTCACCCGGAACAGGAGCACATCAAC
GCCAGCGACGAGGAGAAGAAGAAATGGAGCGGGCGTGCGGTCGAACCCCTGGCTCTACTGGTTCACCCTCAGCAG
CCTTTATCGTACCTCGAAAGACTGATCCAAGCCGAGATCCCACCGATGCGAACCGACGGCCGCGAGAAGCTCCCA
GAGCTAGTCTTCCGAGCCGAAGCCGAAACAGAATCCTCCAAGTCATCATCCGGCGACAAAGACGAGAAAGGTGGC
GACGACGACGGCGTCAACGTAGCCGCCTACTCGGGCCTCGGCCGCGAAGGTCCAGGGAAGAGCAGCGATAAGGCG
CGTTGGGTACGATGGAGCAGCAGCACCGAGGTCGGCGACTTCATCCGCGACGCCGCTCGTGGCCGCGAATTCGCC
ATAGGAATCGAAGGGTTAGATCGCGAGCTGCGGGTAGCGGTCCCGAGCTTCAAGGACAGAACGTACTACCTCCGC
ACACGACTGCGCAAGATGTCGCGGCAAATCGACCAAATGTCCCGCGTCAAGAAAGGGTGCGATCTCGCCGCCCAT
CAGGGAGCAAACAGACTGGCAAAGGGTGGTTTCGCTGCGCTGGCGGGCTGGTGGGGGATCGTCTACTACGTCACC
TTCCACACGGAAATGGGCTGGGATATGGTCGAGCCCGTGACGTATCTGGCAGGACTGACGACCATCATGGCCGGA
TACCTCTGGTTTCTCTTCATCAGCCGCGATCTCAGCTACAAGGCTGCCATGAACCTCACCGTCTCCCGCCGGCAG
ACGGCTCTGTATCAGGAGCGGGGGTTCGACCCGCACAAGTGGGAGCAGTTGGTGCACGAGGCCAATCTGCTGAGG
CGGGAGGTGAAGATGGCGGCTACCGAGTACGATGTCGAGTGGGATGAGATGAGGGACTTGGGCGGTGAGGAGGTG
TTGGAGGTGCTGGAGGAGGAGCGTGGTGATAGGAAGCGTCGGGGTGGGAAGGGGGCCGAGGAGGAGGGGGAGGAG
GAGGAGGAGGAGGAGGATGGCGAGAGGGGAGGGAAGACGAAGGAGTGA
Transcript >Ophcf2|05169
ATGCACGTGACTGCAACGGCACAGCTCAGCACGCTTCTACCACCCATCGTAGGAAGACGCAACAACGACATCCCG
ACCACGCAGTGCGAGAAAGAGGCCGTGGCGAGGCACCGCGCCATGAGCAGTCTCCTGAGACGGCCAGCAGCTCGT
CTCACCGCAGTAACGACGCTCAAACGACAACCCATCACCAGACGAGGCCTGGCATCGCGCCCGCAAGAAGATCAA
GCAAACAGCAACCAAGAATGGCAGCGCCTAACGACCAGCAAAAGCCAGCAAAGAAAAGTCAATGACCGTCCATGG
CAGCGCGAGGGAAGCAACTCCCTTCCCAAGGCCACATCGCCTGACCCGTCCGGCGGTGACTTGACAAAAGGGAGA
CTGTTGACGACGCCCACGCGGCTTCTCAAGCTCATCCTCCCTATGCCCTTTCACCCGGAACAGGAGCACATCAAC
GCCAGCGACGAGGAGAAGAAGAAATGGAGCGGGCGTGCGGTCGAACCCCTGGCTCTACTGGTTCACCCTCAGCAG
CCTTTATCGTACCTCGAAAGACTGATCCAAGCCGAGATCCCACCGATGCGAACCGACGGCCGCGAGAAGCTCCCA
GAGCTAGTCTTCCGAGCCGAAGCCGAAACAGAATCCTCCAAGTCATCATCCGGCGACAAAGACGAGAAAGGTGGC
GACGACGACGGCGTCAACGTAGCCGCCTACTCGGGCCTCGGCCGCGAAGGTCCAGGGAAGAGCAGCGATAAGGCG
CGTTGGGTACGATGGAGCAGCAGCACCGAGGTCGGCGACTTCATCCGCGACGCCGCTCGTGGCCGCGAATTCGCC
ATAGGAATCGAAGGGTTAGATCGCGAGCTGCGGGTAGCGGTCCCGAGCTTCAAGGACAGAACGTACTACCTCCGC
ACACGACTGCGCAAGATGTCGCGGCAAATCGACCAAATGTCCCGCGTCAAGAAAGGGTGCGATCTCGCCGCCCAT
CAGGGAGCAAACAGACTGGCAAAGGGTGGTTTCGCTGCGCTGGCGGGCTGGTGGGGGATCGTCTACTACGTCACC
TTCCACACGGAAATGGGCTGGGATATGGTCGAGCCCGTGACGTATCTGGCAGGACTGACGACCATCATGGCCGGA
TACCTCTGGTTTCTCTTCATCAGCCGCGATCTCAGCTACAAGGCTGCCATGAACCTCACCGTCTCCCGCCGGCAG
ACGGCTCTGTATCAGGAGCGGGGGTTCGACCCGCACAAGTGGGAGCAGTTGGTGCACGAGGCCAATCTGCTGAGG
CGGGAGGTGAAGATGGCGGCTACCGAGTACGATGTCGAGTGGGATGAGATGAGGGACTTGGGCGGTGAGGAGGTG
TTGGAGGTGCTGGAGGAGGAGCGTGGTGATAGGAAGCGTCGGGGTGGGAAGGGGGCCGAGGAGGAGGGGGAGGAG
GAGGAGGAGGAGGAGGATGGCGAGAGGGGAGGGAAGACGAAGGAGTGA
Gene >Ophcf2|05169
ATGCACGTGACTGCAACGGCACAGCTCAGCACGTGAGACACCGTCATCCTGCAGGAATGCTGGCGCGTCGCAGTG
AACACCCATGACATCATCAGGCTTCTACCACCCATCGTAGGAAGACGCAACAACGACATCCCGACCACGCAGTGC
GAGAAAGAGGCCGTGGCGAGGCACCGCGCCATGAGCAGTCTCCTGAGACGGCCAGCAGCTCGTCTCACCGCAGTA
ACGACGCTCAAACGACAACCCATCACCAGACGAGGCCTGGCATCGCGCCCGCAAGAAGATCAAGCAAACAGCAAC
CAAGAATGGCAGCGCCTAACGACCAGCAAAAGCCAGCAAAGAAAAGTCAATGACCGTCCATGGCAGCGCGAGGGA
AGCAACTCCCTTCCCAAGGCCACATCGCCTGACCCGTCCGGCGGTGACTTGACAAAAGGTACGACGCGCAAAAGG
GGGAACTAAACTGTTCAGCTGCGCCGGATAAACAAGAAGGAGTGGGGAAACAAGAGCTGACGCGGGTCGGTAGGG
AGACTGTTGACGACGCCCACGCGGCTTCTCAAGCTCATCCTCCCTATGCCCTTTCACCCGGAACAGGAGCACATC
AACGCCAGCGACGAGGAGAAGAAGAAATGGAGCGGGCGTGCGGTCGAACCCCTGGCTCTACTGGTTCACCCTCAG
CAGCCTTTATCGTACCTCGAAAGACTGATCCAAGCCGAGATCCCACCGATGCGAACCGACGGCCGCGAGAAGCTC
CCAGAGCTAGTCTTCCGAGCCGAAGCCGAAACAGAATCCTCCAAGTCATCATCCGGCGACAAAGACGAGAAAGGT
GGCGACGACGACGGCGTCAACGTAGCCGCCTACTCGGGCCTCGGCCGCGAAGGTCCAGGGAAGAGCAGCGATAAG
GCGCGTTGGGTACGATGGAGCAGCAGCACCGAGGTCGGCGACTTCATCCGCGACGCCGCTCGTGGCCGCGAATTC
GCCATAGGAATCGAAGGGTTAGATCGCGAGCTGCGGGTAGCGGTCCCGAGCTTCAAGGACAGAACGTACTACCTC
CGCACACGACTGCGCAAGATGTCGCGGCAAATCGACCAAATGTCCCGCGTCAAGAAAGGGTGCGATCTCGCCGCC
CATCAGGGAGCAAACAGACTGGCAAAGGGTGGTTTCGCTGCGCTGGCGGGCTGGTGGGGGATCGTCTACTACGTC
ACCTTCCACACGGAAATGGGCTGGGATATGGTCGAGCCCGTGACGTATCTGGCAGGACTGACGACCATCATGGCC
GGATACCTCTGGTTTCTCTTCATCAGCCGCGATCTCAGCTACAAGGCTGCCATGAACCTCACCGTCTCCCGCCGG
CAGACGGCTCTGTATCAGGAGCGGGGGTTCGACCCGCACAAGTGGGAGCAGTTGGTGCACGAGGCCAATCTGCTG
AGGCGGGAGGTGAAGATGGCGGCTACCGAGTACGATGTCGAGTGGGATGAGATGAGGGACTTGGGCGGTGAGGAG
GTGTTGGAGGTGCTGGAGGAGGAGCGTGGTGATAGGAAGCGTCGGGGTGGGAAGGGGGCCGAGGAGGAGGGGGAG
GAGGAGGAGGAGGAGGAGGATGGCGAGAGGGGAGGGAAGACGAAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail