Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05168
Gene name
Locationscaffold_05:2679424..2680255
Strand-
Gene length (bp)831
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain 2.5E-38 123 223
PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain 2.4E-30 34 113

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006801 superoxide metabolic process Yes
GO:0004784 superoxide dismutase activity Yes
GO:0043169 cation binding No
GO:0016209 antioxidant activity No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0072593 reactive oxygen species metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0016721 oxidoreductase activity, acting on superoxide radicals as acceptor No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1373 0.0553 0.0399 0.1018 0.9585 0.2035 0.0265 0.0367 0.0527 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup956
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5029
Ophiocordyceps australis map64 (Brazil) OphauB2|398
Ophiocordyceps camponoti-floridani Ophcf2|05168 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5811
Ophiocordyceps camponoti-rufipedis Ophun1|7121
Ophiocordyceps kimflemingae Ophio5|4361
Ophiocordyceps subramaniannii Hirsu2|718

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05168
MASSLLRTAPKLRAALRPRAAAMASISFVRGKATLPDLPYDYGALEPYISGKIMELHHSKHHQTYINGFNAATEA
LAQAAAKNDAKAATAQAPLLNFHGGGHVNHSLFWENLAPKGKGGGGEPEGKLLTAINEDFGSLDAFKKQTNTALA
AIQGSGWAWLVKDKSSGTLSVVTRANQDPVTGNLEPLLGIDAWEHAYYLQYQNRKAEYFEAIWNVINWSTVAGRF
EN*
Coding >Ophcf2|05168
ATGGCGTCTTCACTCTTACGCACGGCGCCGAAGCTGAGAGCAGCTCTCCGTCCGCGGGCTGCGGCCATGGCATCT
ATCAGCTTCGTCCGTGGGAAGGCGACGCTTCCTGATCTCCCGTATGACTACGGTGCTCTCGAACCTTACATCTCT
GGCAAGATCATGGAGCTTCACCATTCGAAGCATCACCAGACATACATCAACGGCTTCAACGCTGCAACCGAAGCC
CTCGCTCAAGCAGCAGCCAAGAACGACGCAAAGGCTGCCACCGCCCAAGCTCCCCTTCTCAACTTCCACGGCGGC
GGCCACGTCAACCACTCTCTCTTCTGGGAGAACCTGGCTCCGAAAGGCAAGGGCGGAGGTGGTGAGCCCGAGGGC
AAGCTTCTCACTGCCATCAACGAAGACTTTGGCTCCTTGGACGCCTTCAAGAAGCAGACAAATACCGCCCTAGCC
GCCATTCAGGGCTCCGGCTGGGCCTGGCTCGTCAAGGACAAGTCGTCGGGCACGCTGAGCGTCGTCACTCGCGCC
AACCAAGACCCCGTGACCGGGAACCTGGAACCTCTGCTCGGCATAGACGCCTGGGAGCATGCCTACTACCTGCAA
TACCAGAATCGCAAGGCGGAATACTTTGAAGCCATTTGGAACGTCATCAACTGGAGCACGGTGGCGGGACGGTTT
GAAAACTAA
Transcript >Ophcf2|05168
ATGGCGTCTTCACTCTTACGCACGGCGCCGAAGCTGAGAGCAGCTCTCCGTCCGCGGGCTGCGGCCATGGCATCT
ATCAGCTTCGTCCGTGGGAAGGCGACGCTTCCTGATCTCCCGTATGACTACGGTGCTCTCGAACCTTACATCTCT
GGCAAGATCATGGAGCTTCACCATTCGAAGCATCACCAGACATACATCAACGGCTTCAACGCTGCAACCGAAGCC
CTCGCTCAAGCAGCAGCCAAGAACGACGCAAAGGCTGCCACCGCCCAAGCTCCCCTTCTCAACTTCCACGGCGGC
GGCCACGTCAACCACTCTCTCTTCTGGGAGAACCTGGCTCCGAAAGGCAAGGGCGGAGGTGGTGAGCCCGAGGGC
AAGCTTCTCACTGCCATCAACGAAGACTTTGGCTCCTTGGACGCCTTCAAGAAGCAGACAAATACCGCCCTAGCC
GCCATTCAGGGCTCCGGCTGGGCCTGGCTCGTCAAGGACAAGTCGTCGGGCACGCTGAGCGTCGTCACTCGCGCC
AACCAAGACCCCGTGACCGGGAACCTGGAACCTCTGCTCGGCATAGACGCCTGGGAGCATGCCTACTACCTGCAA
TACCAGAATCGCAAGGCGGAATACTTTGAAGCCATTTGGAACGTCATCAACTGGAGCACGGTGGCGGGACGGTTT
GAAAACTAA
Gene >Ophcf2|05168
ATGGCGTCTTCACTCTTACGCACGGCGCCGAAGCTGAGAGCAGCTCTCCGTCCGCGGGCTGCGGCCATGGCATCT
ATCAGCTTCGTCCGTGGGAAGGCGACGCTTCCTGATCTCCCGTGTGAGAAGAGGTCTCGGTCCCCTTTGAATCGT
GGCTAAAAACGGCTTGACAGATGACTACGGTGCTCTCGAACCTTACATCTCTGGCAAGATCATGGAGCTTCACCA
TTCGAAGCATCACCAGACATACATCAACGGCTTCAACGCTGCAACCGAAGCCCTCGCTCAAGCAGCAGCCAAGAA
CGACGCAAAGGCTGCCACCGCCCAAGCTCCCCTTCTCAACTTCCACGGCGGCGGCCACGTCAACCACTCTCTCTT
CTGGGAGAACCTGGCTCCGAAAGGCAAGGGCGGAGGTGGTGAGCCCGAGGGCAAGCTTCTCGTACGTCTATGAAG
CGATGTCCCCATGAATCATCGATGCTTCTACCTCCCCCGGCGTAAGGGAGTGCAAAAGGGATGAGTCTGACTATC
AGCCAGACTGCCATCAACGAAGACTTTGGCTCCTTGGACGCCTTCAAGAAGCAGACAAATACCGCCCTAGCCGCC
ATTCAGGGCTCCGGCTGGGCCTGGCTCGTCAAGGACAAGTCGTCGGGCACGCTGAGCGTCGTCACTCGCGCCAAC
CAAGACCCCGTGACCGGGAACCTGGAACCTCTGCTCGGCATAGACGCCTGGGAGCATGCCTACTACCTGCAATAC
CAGAATCGCAAGGCGGAATACTTTGAAGCCATTTGGAACGTCATCAACTGGAGCACGGTGGCGGGACGGTTTGAA
AACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail