Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05164
Gene name
Locationscaffold_05:2665321..2668663
Strand-
Gene length (bp)3342
Transcript length (bp)3282
Coding sequence length (bp)3282
Protein length (aa) 1094

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08642 Rxt3 Histone deacetylation protein Rxt3 2.4E-33 850 982

GO

GO Term Description Terminal node
GO:0016575 histone deacetylation Yes
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016570 histone modification No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006476 protein deacetylation No
GO:0036211 protein modification process No
GO:0008150 biological_process No
GO:0098732 macromolecule deacylation No
GO:0035601 protein deacylation No
GO:0043170 macromolecule metabolic process No
GO:0043412 macromolecule modification No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.206 0.9669 0.0584 0.0313 0.0265 0.0038 0.0218 0.0058 0.0033 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup942
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6529
Ophiocordyceps australis 1348a (Ghana) OphauG2|6781
Ophiocordyceps australis map64 (Brazil) OphauB2|404
Ophiocordyceps camponoti-floridani Ophcf2|05164 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6863
Ophiocordyceps kimflemingae Ophio5|8393
Ophiocordyceps subramaniannii Hirsu2|685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05164
MERRQQQHQQPQLKHHQLPPQHPSQHQLQHQLQHQHQQHQQHHQQQLPPAAASPRNFAAAPSFGRHRATPPPSRS
PSSSSAYVADHRRPSDSSPYYPSTARLPDLPPSARPLARSMAPPPPTSPGGHPLPQSSYGPPPPRPPPVAIGPPI
AFPASRDLPVPRAGSAGMSISAMLGGPPPPASRDVAQQQQQQQQQQQQPASSSSSQHYPPPPTASSAGPGSGFPP
PVQASPRMHSASSDYPPFRRPQTPDHQRPYDPRSSAAPSPRGPYSTPDLQRYGTPQTQAAPGYHPRHPSAPADAP
RDPGRMSAAGQPKPYMPPNMARPEDTYPRRDDVGRLEYNPERPGPPRPYASYDDRYRAAAERDRQGPAHPEPRGP
PAEVRGGRERAYSGGDAHRQAMPHEMGRRESHPGPPPYARPMTEGRPPEGRDQREVQWGRHGPEPNYRAPMDHQR
QPAEPPAPGSYPPPHPPPPPHPPPPPPHPPPPPPPPHHGPPYPHERFPPHGPPASGGPPPPPPFEQQDRSHLHVQ
HQPPHPLHRPNEAPASMAYGPSPFDSPRNRGAEELSGSGHQRNLLAVQDMARKGRVSPLPQAVQGAQPQHPGPGA
EPGIKSEFGRMFSGIGSGVGAIGVQGQQQQQQQQPPAPQQAMAAVLTYGNLAPGGHAASIKREDADVQAPVDSGG
GIKAKGRRRKLKDDETRDDDGLERPASGGRASKRPRAHHHHHHHHHHHHHAADETSSGVKGVKTTSPADKGSTAP
HHHHHHHHGSRPSQQSSSRQRAQSPVAVVIPPKTKTTVSSTAVVDAVAHRPRHHLGDFIYEAGLRPVRQLPMLPT
KRAFSSNPKPLPWEVIKDKENCILTVKVPRVHLSEDALEEITARAYLWGTDVYTDDSDIVAACIHGGWVRGEWAE
KVDGHVWDAAGEDDQDNEKGRKAKRRGDEAPDAESEGLITSPPESGPIEVPANRDLHVNVLILPRLTRYAATTRY
GMASREFGGQYGTRLSAHDGISYMIKSIRWVENGGQPQARLRGKARRERMRRVMREVTTTFGNGKGNGGHVIERR
RQQQQQPPPQPQTDEEVVERVDGEVEGEVRVVMGEGEATERRG*
Coding >Ophcf2|05164
ATGGAGCGAAGGCAGCAGCAGCACCAGCAGCCGCAGCTCAAACACCACCAGCTCCCGCCTCAACATCCTTCGCAG
CACCAGCTCCAGCACCAGCTCCAGCACCAGCACCAGCAGCACCAGCAGCATCATCAGCAACAGCTGCCGCCCGCC
GCCGCCTCGCCTCGCAACTTTGCCGCCGCTCCGTCCTTCGGCCGACATCGTGCCACGCCGCCGCCGAGCCGGTCG
CCCTCTTCGTCATCGGCCTACGTCGCAGACCACCGACGCCCCTCCGACTCGTCGCCCTACTATCCTTCGACTGCC
CGACTGCCCGACCTGCCGCCGTCTGCCCGACCGCTGGCCCGATCCATGGCGCCGCCTCCCCCGACGTCGCCCGGC
GGACACCCCCTGCCGCAGTCTTCGTATGGCCCTCCGCCTCCGAGGCCGCCTCCCGTCGCCATCGGTCCTCCGATC
GCCTTCCCGGCTTCTCGTGACCTGCCCGTTCCGCGAGCTGGCAGCGCTGGTATGTCCATCTCCGCCATGCTCGGC
GGTCCGCCACCACCGGCCTCGCGCGACGTCGCCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCGCC
TCGTCCTCCTCATCTCAGCATTACCCTCCTCCGCCTACCGCTTCTTCGGCCGGTCCGGGTTCTGGCTTCCCGCCG
CCCGTTCAGGCCTCGCCGCGTATGCATTCGGCCTCGTCTGACTATCCGCCCTTCCGACGACCCCAGACCCCCGAT
CACCAGCGGCCCTACGACCCTCGCTCGAGCGCCGCCCCCTCCCCACGCGGCCCCTACTCGACGCCCGACCTCCAG
CGCTACGGCACGCCCCAGACCCAAGCTGCCCCAGGCTATCACCCTCGCCACCCGTCCGCTCCGGCCGACGCCCCA
AGAGACCCCGGCAGGATGTCGGCCGCCGGCCAGCCGAAGCCCTATATGCCACCGAACATGGCCCGGCCCGAGGAC
ACGTACCCTCGTCGCGACGATGTGGGCCGTCTCGAGTACAACCCCGAGCGTCCGGGTCCGCCAAGACCCTATGCC
TCCTATGACGACCGCTACCGAGCAGCCGCCGAGCGCGATCGCCAGGGCCCAGCCCACCCAGAGCCTCGCGGGCCG
CCCGCCGAGGTGCGAGGAGGTCGGGAGCGAGCCTACTCTGGAGGCGACGCCCATCGGCAAGCCATGCCGCATGAG
ATGGGCCGCCGCGAGTCTCACCCCGGTCCGCCCCCGTACGCCCGACCGATGACCGAGGGCAGGCCGCCCGAGGGT
CGCGATCAGAGAGAGGTTCAGTGGGGACGTCACGGTCCCGAGCCCAACTATCGCGCACCCATGGACCACCAGCGA
CAGCCGGCCGAGCCTCCCGCTCCGGGTTCCTATCCTCCTCCTCATCCTCCTCCTCCTCCTCATCCTCCTCCTCCT
CCTCCTCATCCTCCTCCTCCTCCGCCGCCGCCGCATCACGGGCCGCCGTATCCGCATGAGAGGTTCCCGCCTCAT
GGTCCCCCCGCCTCCGGTGGGCCGCCGCCGCCGCCGCCCTTTGAGCAGCAGGACCGCTCGCACCTCCACGTGCAA
CACCAGCCCCCCCATCCTCTGCATCGGCCCAACGAGGCGCCGGCTTCCATGGCGTACGGGCCATCGCCCTTCGAC
TCGCCCCGCAACCGCGGCGCCGAGGAGCTGTCCGGGAGCGGCCACCAGCGGAACCTGCTGGCCGTCCAAGACATG
GCCCGTAAGGGACGTGTCTCACCTCTTCCACAGGCTGTCCAGGGAGCGCAGCCTCAGCATCCCGGTCCCGGCGCC
GAACCGGGCATTAAGAGCGAGTTCGGCCGCATGTTTTCGGGCATCGGTAGCGGCGTCGGTGCCATCGGCGTTCAG
GGCCAGCAGCAACAGCAGCAGCAACAACCGCCAGCCCCGCAGCAGGCCATGGCTGCCGTTCTCACCTACGGAAAC
CTCGCGCCGGGCGGTCACGCGGCCTCGATCAAGCGAGAGGACGCCGACGTCCAGGCTCCCGTCGATTCGGGGGGT
GGAATCAAGGCCAAGGGCAGGAGACGGAAGCTCAAGGACGACGAGACGCGAGATGATGACGGTTTGGAAAGGCCG
GCTTCGGGCGGCCGCGCCAGCAAACGTCCCAGGGCTCACCATCATCACCATCATCATCATCACCACCATCACCAC
GCAGCCGACGAGACGTCGAGCGGCGTCAAGGGTGTCAAGACGACGTCTCCGGCGGACAAGGGCTCGACGGCGCCT
CACCACCACCACCATCATCATCACGGCTCACGACCGTCGCAGCAATCGTCGTCGAGACAGAGAGCGCAGAGCCCG
GTAGCGGTGGTGATACCGCCCAAGACCAAGACGACGGTCTCGTCAACTGCAGTGGTGGACGCCGTCGCCCATCGT
CCGCGGCATCATCTGGGAGACTTCATCTACGAGGCCGGGCTGCGGCCGGTACGGCAGCTACCCATGCTACCGACA
AAGAGGGCCTTCTCGTCGAACCCGAAGCCGTTGCCGTGGGAGGTGATCAAAGACAAGGAGAACTGCATCCTGACA
GTCAAGGTGCCACGGGTGCACCTGTCGGAGGACGCGCTCGAGGAGATAACGGCGCGGGCATATCTCTGGGGAACG
GACGTGTACACGGACGACTCGGACATTGTGGCCGCCTGCATCCACGGCGGCTGGGTGCGAGGGGAATGGGCGGAA
AAGGTGGACGGTCACGTCTGGGACGCCGCCGGGGAAGACGACCAAGACAACGAAAAGGGACGCAAGGCCAAGCGG
CGGGGGGACGAGGCGCCGGACGCCGAGTCGGAGGGCCTCATCACGTCGCCGCCGGAGTCCGGGCCGATCGAGGTT
CCGGCCAACCGGGACCTACACGTCAATGTGCTGATCCTGCCTCGGCTGACGCGATATGCGGCGACGACTCGGTAC
GGCATGGCGAGCCGTGAGTTCGGAGGCCAGTACGGCACGCGACTGTCGGCGCACGACGGCATCAGCTACATGATC
AAGAGCATCCGGTGGGTGGAGAACGGGGGACAGCCACAGGCCCGACTCCGGGGCAAGGCGCGGAGGGAGCGGATG
CGGAGGGTGATGCGGGAGGTGACGACCACGTTTGGGAACGGGAAGGGGAATGGGGGGCATGTCATCGAGCGGCGA
AGGCAGCAGCAGCAGCAGCCGCCGCCGCAGCCGCAGACCGATGAAGAGGTCGTCGAGCGGGTAGACGGGGAGGTC
GAAGGGGAGGTGAGGGTGGTGATGGGGGAGGGAGAGGCAACGGAGCGAAGGGGATAA
Transcript >Ophcf2|05164
ATGGAGCGAAGGCAGCAGCAGCACCAGCAGCCGCAGCTCAAACACCACCAGCTCCCGCCTCAACATCCTTCGCAG
CACCAGCTCCAGCACCAGCTCCAGCACCAGCACCAGCAGCACCAGCAGCATCATCAGCAACAGCTGCCGCCCGCC
GCCGCCTCGCCTCGCAACTTTGCCGCCGCTCCGTCCTTCGGCCGACATCGTGCCACGCCGCCGCCGAGCCGGTCG
CCCTCTTCGTCATCGGCCTACGTCGCAGACCACCGACGCCCCTCCGACTCGTCGCCCTACTATCCTTCGACTGCC
CGACTGCCCGACCTGCCGCCGTCTGCCCGACCGCTGGCCCGATCCATGGCGCCGCCTCCCCCGACGTCGCCCGGC
GGACACCCCCTGCCGCAGTCTTCGTATGGCCCTCCGCCTCCGAGGCCGCCTCCCGTCGCCATCGGTCCTCCGATC
GCCTTCCCGGCTTCTCGTGACCTGCCCGTTCCGCGAGCTGGCAGCGCTGGTATGTCCATCTCCGCCATGCTCGGC
GGTCCGCCACCACCGGCCTCGCGCGACGTCGCCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCGCC
TCGTCCTCCTCATCTCAGCATTACCCTCCTCCGCCTACCGCTTCTTCGGCCGGTCCGGGTTCTGGCTTCCCGCCG
CCCGTTCAGGCCTCGCCGCGTATGCATTCGGCCTCGTCTGACTATCCGCCCTTCCGACGACCCCAGACCCCCGAT
CACCAGCGGCCCTACGACCCTCGCTCGAGCGCCGCCCCCTCCCCACGCGGCCCCTACTCGACGCCCGACCTCCAG
CGCTACGGCACGCCCCAGACCCAAGCTGCCCCAGGCTATCACCCTCGCCACCCGTCCGCTCCGGCCGACGCCCCA
AGAGACCCCGGCAGGATGTCGGCCGCCGGCCAGCCGAAGCCCTATATGCCACCGAACATGGCCCGGCCCGAGGAC
ACGTACCCTCGTCGCGACGATGTGGGCCGTCTCGAGTACAACCCCGAGCGTCCGGGTCCGCCAAGACCCTATGCC
TCCTATGACGACCGCTACCGAGCAGCCGCCGAGCGCGATCGCCAGGGCCCAGCCCACCCAGAGCCTCGCGGGCCG
CCCGCCGAGGTGCGAGGAGGTCGGGAGCGAGCCTACTCTGGAGGCGACGCCCATCGGCAAGCCATGCCGCATGAG
ATGGGCCGCCGCGAGTCTCACCCCGGTCCGCCCCCGTACGCCCGACCGATGACCGAGGGCAGGCCGCCCGAGGGT
CGCGATCAGAGAGAGGTTCAGTGGGGACGTCACGGTCCCGAGCCCAACTATCGCGCACCCATGGACCACCAGCGA
CAGCCGGCCGAGCCTCCCGCTCCGGGTTCCTATCCTCCTCCTCATCCTCCTCCTCCTCCTCATCCTCCTCCTCCT
CCTCCTCATCCTCCTCCTCCTCCGCCGCCGCCGCATCACGGGCCGCCGTATCCGCATGAGAGGTTCCCGCCTCAT
GGTCCCCCCGCCTCCGGTGGGCCGCCGCCGCCGCCGCCCTTTGAGCAGCAGGACCGCTCGCACCTCCACGTGCAA
CACCAGCCCCCCCATCCTCTGCATCGGCCCAACGAGGCGCCGGCTTCCATGGCGTACGGGCCATCGCCCTTCGAC
TCGCCCCGCAACCGCGGCGCCGAGGAGCTGTCCGGGAGCGGCCACCAGCGGAACCTGCTGGCCGTCCAAGACATG
GCCCGTAAGGGACGTGTCTCACCTCTTCCACAGGCTGTCCAGGGAGCGCAGCCTCAGCATCCCGGTCCCGGCGCC
GAACCGGGCATTAAGAGCGAGTTCGGCCGCATGTTTTCGGGCATCGGTAGCGGCGTCGGTGCCATCGGCGTTCAG
GGCCAGCAGCAACAGCAGCAGCAACAACCGCCAGCCCCGCAGCAGGCCATGGCTGCCGTTCTCACCTACGGAAAC
CTCGCGCCGGGCGGTCACGCGGCCTCGATCAAGCGAGAGGACGCCGACGTCCAGGCTCCCGTCGATTCGGGGGGT
GGAATCAAGGCCAAGGGCAGGAGACGGAAGCTCAAGGACGACGAGACGCGAGATGATGACGGTTTGGAAAGGCCG
GCTTCGGGCGGCCGCGCCAGCAAACGTCCCAGGGCTCACCATCATCACCATCATCATCATCACCACCATCACCAC
GCAGCCGACGAGACGTCGAGCGGCGTCAAGGGTGTCAAGACGACGTCTCCGGCGGACAAGGGCTCGACGGCGCCT
CACCACCACCACCATCATCATCACGGCTCACGACCGTCGCAGCAATCGTCGTCGAGACAGAGAGCGCAGAGCCCG
GTAGCGGTGGTGATACCGCCCAAGACCAAGACGACGGTCTCGTCAACTGCAGTGGTGGACGCCGTCGCCCATCGT
CCGCGGCATCATCTGGGAGACTTCATCTACGAGGCCGGGCTGCGGCCGGTACGGCAGCTACCCATGCTACCGACA
AAGAGGGCCTTCTCGTCGAACCCGAAGCCGTTGCCGTGGGAGGTGATCAAAGACAAGGAGAACTGCATCCTGACA
GTCAAGGTGCCACGGGTGCACCTGTCGGAGGACGCGCTCGAGGAGATAACGGCGCGGGCATATCTCTGGGGAACG
GACGTGTACACGGACGACTCGGACATTGTGGCCGCCTGCATCCACGGCGGCTGGGTGCGAGGGGAATGGGCGGAA
AAGGTGGACGGTCACGTCTGGGACGCCGCCGGGGAAGACGACCAAGACAACGAAAAGGGACGCAAGGCCAAGCGG
CGGGGGGACGAGGCGCCGGACGCCGAGTCGGAGGGCCTCATCACGTCGCCGCCGGAGTCCGGGCCGATCGAGGTT
CCGGCCAACCGGGACCTACACGTCAATGTGCTGATCCTGCCTCGGCTGACGCGATATGCGGCGACGACTCGGTAC
GGCATGGCGAGCCGTGAGTTCGGAGGCCAGTACGGCACGCGACTGTCGGCGCACGACGGCATCAGCTACATGATC
AAGAGCATCCGGTGGGTGGAGAACGGGGGACAGCCACAGGCCCGACTCCGGGGCAAGGCGCGGAGGGAGCGGATG
CGGAGGGTGATGCGGGAGGTGACGACCACGTTTGGGAACGGGAAGGGGAATGGGGGGCATGTCATCGAGCGGCGA
AGGCAGCAGCAGCAGCAGCCGCCGCCGCAGCCGCAGACCGATGAAGAGGTCGTCGAGCGGGTAGACGGGGAGGTC
GAAGGGGAGGTGAGGGTGGTGATGGGGGAGGGAGAGGCAACGGAGCGAAGGGGATAA
Gene >Ophcf2|05164
ATGGAGCGAAGGCAGCAGCAGCACCAGCAGCCGCAGCTCAAACACCACCAGCTCCCGCCTCAACATCCTTCGCAG
CACCAGCTCCAGCACCAGCTCCAGCACCAGCACCAGCAGCACCAGCAGCATCATCAGCAACAGCTGCCGCCCGCC
GCCGCCTCGCCTCGCAACTTTGCCGCCGCTCCGTCCTTCGGCCGACATCGTGCCACGCCGCCGCCGAGCCGGTCG
CCCTCTTCGTCATCGGCCTACGTCGCAGACCACCGACGCCCCTCCGACTCGTCGCCCTACTATCCTTCGACTGCC
CGACTGCCCGACCTGCCGCCGTCTGCCCGACCGCTGGCCCGATCCATGGCGCCGCCTCCCCCGACGTCGCCCGGC
GGACACCCCCTGCCGCAGTCTTCGTATGGCCCTCCGCCTCCGAGGCCGCCTCCCGTCGCCATCGGTCCTCCGATC
GCCTTCCCGGCTTCTCGTGACCTGCCCGTTCCGCGAGCTGGCAGCGCTGGTATGTCCATCTCCGCCATGCTCGGC
GGTCCGCCACCACCGGCCTCGCGCGACGTCGCCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCGCC
TCGTCCTCCTCATCTCAGCATTACCCTCCTCCGCCTACCGCTTCTTCGGCCGGTCCGGGTTCTGGCTTCCCGCCG
CCCGTTCAGGCCTCGCCGCGTATGCATTCGGCCTCGTCTGACTATCCGCCCTTCCGACGACCCCAGACCCCCGAT
CACCAGCGGCCCTACGACCCTCGCTCGAGCGCCGCCCCCTCCCCACGCGGCCCCTACTCGACGCCCGACCTCCAG
CGCTACGGCACGCCCCAGACCCAAGCTGCCCCAGGCTATCACCCTCGCCACCCGTCCGCTCCGGCCGACGCCCCA
AGAGACCCCGGCAGGATGTCGGCCGCCGGCCAGCCGAAGCCCTATATGCCACCGAACATGGCCCGGCCCGAGGAC
ACGTACCCTCGTCGCGACGATGTGGGCCGTCTCGAGTACAACCCCGAGCGTCCGGGTCCGCCAAGACCCTATGCC
TCCTATGACGACCGCTACCGAGCAGCCGCCGAGCGCGATCGCCAGGGCCCAGCCCACCCAGAGCCTCGCGGGCCG
CCCGCCGAGGTGCGAGGAGGTCGGGAGCGAGCCTACTCTGGAGGCGACGCCCATCGGCAAGCCATGCCGCATGAG
ATGGGCCGCCGCGAGTCTCACCCCGGTCCGCCCCCGTACGCCCGACCGATGACCGAGGGCAGGCCGCCCGAGGGT
CGCGATCAGAGAGAGGTTCAGTGGGGACGTCACGGTCCCGAGCCCAACTATCGCGCACCCATGGACCACCAGCGA
CAGCCGGCCGAGCCTCCCGCTCCGGGTTCCTATCCTCCTCCTCATCCTCCTCCTCCTCCTCATCCTCCTCCTCCT
CCTCCTCATCCTCCTCCTCCTCCGCCGCCGCCGCATCACGGGCCGCCGTATCCGCATGAGAGGTTCCCGCCTCAT
GGTCCCCCCGCCTCCGGTGGGCCGCCGCCGCCGCCGCCCTTTGAGCAGCAGGACCGCTCGCACCTCCACGTGCAA
CACCAGCCCCCCCATCCTCTGCATCGGCCCAACGAGGCGCCGGCTTCCATGGCGTACGGGCCATCGCCCTTCGAC
TCGCCCCGCAACCGCGGCGCCGAGGAGCTGTCCGGGAGCGGCCACCAGCGGAACCTGCTGGCCGTCCAAGACATG
GCCCGTAAGGGACGTGTCTCACCTCTTCCACAGGCTGTCCAGGGAGCGCAGCCTCAGCATCCCGGTCCCGGCGCC
GAACCGGGCATTAAGAGCGAGTTCGGCCGCATGTTTTCGGGCATCGGTAGCGGCGTCGGTGCCATCGGCGTTCAG
GGCCAGCAGCAACAGCAGCAGCAACAACCGCCAGCCCCGCAGCAGGCCATGGCTGCCGTTCTCACCTACGGAAAC
CTCGCGCCGGGCGGTCACGCGGCCTCGATCAAGCGAGAGGACGCCGACGTCCAGGCTCCCGTCGATTCGGGGGGT
GGAATCAAGGCCAAGGGCAGGAGACGGAAGCTCAAGGACGACGAGACGCGAGATGATGACGGTTTGGAAAGGCCG
GCTTCGGGCGGCCGCGCCAGCAAACGTCCCAGGGCTCACCATCATCACCAGTATGCTTCCTCTCTCCCCCGCCCT
ACTCTCTTTGGGGAGCCGGACTAACTCGGACGTAGTCATCATCATCACCACCATCACCACGCAGCCGACGAGACG
TCGAGCGGCGTCAAGGGTGTCAAGACGACGTCTCCGGCGGACAAGGGCTCGACGGCGCCTCACCACCACCACCAT
CATCATCACGGCTCACGACCGTCGCAGCAATCGTCGTCGAGACAGAGAGCGCAGAGCCCGGTAGCGGTGGTGATA
CCGCCCAAGACCAAGACGACGGTCTCGTCAACTGCAGTGGTGGACGCCGTCGCCCATCGTCCGCGGCATCATCTG
GGAGACTTCATCTACGAGGCCGGGCTGCGGCCGGTACGGCAGCTACCCATGCTACCGACAAAGAGGGCCTTCTCG
TCGAACCCGAAGCCGTTGCCGTGGGAGGTGATCAAAGACAAGGAGAACTGCATCCTGACAGTCAAGGTGCCACGG
GTGCACCTGTCGGAGGACGCGCTCGAGGAGATAACGGCGCGGGCATATCTCTGGGGAACGGACGTGTACACGGAC
GACTCGGACATTGTGGCCGCCTGCATCCACGGCGGCTGGGTGCGAGGGGAATGGGCGGAAAAGGTGGACGGTCAC
GTCTGGGACGCCGCCGGGGAAGACGACCAAGACAACGAAAAGGGACGCAAGGCCAAGCGGCGGGGGGACGAGGCG
CCGGACGCCGAGTCGGAGGGCCTCATCACGTCGCCGCCGGAGTCCGGGCCGATCGAGGTTCCGGCCAACCGGGAC
CTACACGTCAATGTGCTGATCCTGCCTCGGCTGACGCGATATGCGGCGACGACTCGGTACGGCATGGCGAGCCGT
GAGTTCGGAGGCCAGTACGGCACGCGACTGTCGGCGCACGACGGCATCAGCTACATGATCAAGAGCATCCGGTGG
GTGGAGAACGGGGGACAGCCACAGGCCCGACTCCGGGGCAAGGCGCGGAGGGAGCGGATGCGGAGGGTGATGCGG
GAGGTGACGACCACGTTTGGGAACGGGAAGGGGAATGGGGGGCATGTCATCGAGCGGCGAAGGCAGCAGCAGCAG
CAGCCGCCGCCGCAGCCGCAGACCGATGAAGAGGTCGTCGAGCGGGTAGACGGGGAGGTCGAAGGGGAGGTGAGG
GTGGTGATGGGGGAGGGAGAGGCAACGGAGCGAAGGGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail