Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05163
Gene name
Locationscaffold_05:2661752..2663303
Strand-
Gene length (bp)1551
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1382 0.2416 0.2085 0.1133 0.0911 0.0066 0.4845 0.2098 0.8917 0.0229

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.02 16.95 47.08
Alive In ants, during behavior modification 47.72 25.11 70.33
Dead In ants, recently dead 60.12 33.91 86.33

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.050540 no
Alive Dead 0.188694 no
Dead Fungus 0.001043 yes

Orthologs

Orthofinder run ID4
Orthogroup5778
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7469
Ophiocordyceps australis map64 (Brazil) OphauB2|6454
Ophiocordyceps camponoti-floridani Ophcf2|05163 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1088
Ophiocordyceps kimflemingae Ophio5|3430
Ophiocordyceps subramaniannii Hirsu2|9600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05163
MMGFSRCVPRRPVVLVSVSLLFSFLVLRLLVTHDSSSWHRLGINRQSQQPGVKPYPQTNQSTLHILLPATHSDVN
LCKTLLTLTMAGYPSPHIVAWGGKDDDGALRGGGSHNAKITSALAFVNDAERRRERGGFDDELVLMVDAYDVWFQ
LPVDVLLARYRSILADDEVRVRHRMGNSYEHGKIGHKVIFGAGKRCSPNQLHTLACYAVPESPLPADTHGVSTDS
VLGRTFMSNGRQRFLVSGYMLGSVGAVRTVLERANRKLDECVGRTGVAFDNGSGDADFCYRGSDQSIFVEMFAEQ
EARREYLRRKHRSLLDPIMEVLIPNRPGSPPPKTHIMTEPISDMLSPSFPHQPFDASSVQDSEMAIVLDYFSLLG
FQTSNAEFDGRFLRHDLPLGPQAGKTGLFDSTTWGSIPLFTDMCTGAIPVMLHHNSVDKTWREHAWPNAWWHGRA
RALLEGRRGRGRGLGRGVRG*
Coding >Ophcf2|05163
ATGATGGGTTTTTCGAGGTGCGTGCCGAGGAGGCCTGTTGTCTTGGTGTCTGTGTCGTTGCTGTTTTCGTTTTTG
GTGCTGAGGTTGTTGGTTACGCATGACTCGTCGTCATGGCATCGTCTAGGCATCAACCGTCAAAGCCAGCAACCC
GGCGTGAAACCCTACCCGCAAACCAACCAGTCGACCCTACACATTCTCCTCCCAGCAACCCACTCAGACGTGAAC
CTCTGCAAAACGCTCCTCACCTTGACCATGGCCGGATACCCGTCTCCCCATATCGTGGCCTGGGGGGGCAAAGAC
GACGACGGGGCTTTGAGGGGGGGTGGTTCTCATAACGCCAAGATTACTTCTGCGCTGGCTTTCGTTAATGATGCC
GAGAGGAGGAGGGAGAGAGGTGGGTTTGATGACGAGTTGGTACTCATGGTGGATGCCTATGACGTCTGGTTTCAG
CTTCCGGTCGACGTTCTCCTCGCACGATATCGTTCCATCCTCGCTGACGATGAGGTCCGCGTGAGACACCGAATG
GGAAATTCGTACGAGCACGGAAAGATAGGACACAAGGTCATCTTCGGCGCCGGAAAACGCTGCTCGCCGAACCAG
CTCCACACTCTAGCCTGCTACGCCGTCCCCGAATCCCCCCTCCCGGCGGACACGCACGGCGTCTCGACCGATTCC
GTGCTGGGCCGCACCTTTATGAGCAACGGCCGGCAGCGCTTCCTGGTGTCCGGGTATATGCTCGGGAGTGTCGGT
GCGGTGAGGACCGTGCTGGAGAGGGCGAATCGGAAGTTGGACGAGTGTGTCGGGAGGACGGGCGTCGCTTTCGAC
AACGGGTCTGGGGATGCGGATTTCTGTTACAGGGGGAGTGATCAGAGCATCTTTGTCGAGATGTTTGCCGAGCAG
GAGGCGAGGAGAGAGTATCTTCGGAGGAAACACCGTTCTCTCTTGGACCCCATCATGGAAGTCCTCATCCCTAAC
CGTCCAGGCTCCCCTCCTCCCAAGACGCACATCATGACGGAGCCGATATCGGACATGCTCTCGCCGTCATTCCCC
CACCAACCCTTTGACGCCTCCTCCGTTCAAGACTCCGAGATGGCCATTGTCCTCGATTACTTTTCTCTCCTCGGC
TTCCAGACTTCAAACGCAGAGTTCGACGGCCGCTTCCTCCGTCACGACCTCCCTCTAGGACCCCAAGCCGGAAAG
ACGGGCCTCTTCGACTCCACGACGTGGGGGAGCATCCCGCTCTTCACCGACATGTGCACGGGGGCCATCCCCGTC
ATGCTGCATCATAACTCGGTGGACAAGACGTGGAGGGAGCACGCGTGGCCGAACGCGTGGTGGCATGGGAGGGCG
AGGGCCTTGCTGGAGGGGAGGAGGGGGAGGGGTCGAGGCCTTGGTCGGGGGGTTCGAGGTTGA
Transcript >Ophcf2|05163
ATGATGGGTTTTTCGAGGTGCGTGCCGAGGAGGCCTGTTGTCTTGGTGTCTGTGTCGTTGCTGTTTTCGTTTTTG
GTGCTGAGGTTGTTGGTTACGCATGACTCGTCGTCATGGCATCGTCTAGGCATCAACCGTCAAAGCCAGCAACCC
GGCGTGAAACCCTACCCGCAAACCAACCAGTCGACCCTACACATTCTCCTCCCAGCAACCCACTCAGACGTGAAC
CTCTGCAAAACGCTCCTCACCTTGACCATGGCCGGATACCCGTCTCCCCATATCGTGGCCTGGGGGGGCAAAGAC
GACGACGGGGCTTTGAGGGGGGGTGGTTCTCATAACGCCAAGATTACTTCTGCGCTGGCTTTCGTTAATGATGCC
GAGAGGAGGAGGGAGAGAGGTGGGTTTGATGACGAGTTGGTACTCATGGTGGATGCCTATGACGTCTGGTTTCAG
CTTCCGGTCGACGTTCTCCTCGCACGATATCGTTCCATCCTCGCTGACGATGAGGTCCGCGTGAGACACCGAATG
GGAAATTCGTACGAGCACGGAAAGATAGGACACAAGGTCATCTTCGGCGCCGGAAAACGCTGCTCGCCGAACCAG
CTCCACACTCTAGCCTGCTACGCCGTCCCCGAATCCCCCCTCCCGGCGGACACGCACGGCGTCTCGACCGATTCC
GTGCTGGGCCGCACCTTTATGAGCAACGGCCGGCAGCGCTTCCTGGTGTCCGGGTATATGCTCGGGAGTGTCGGT
GCGGTGAGGACCGTGCTGGAGAGGGCGAATCGGAAGTTGGACGAGTGTGTCGGGAGGACGGGCGTCGCTTTCGAC
AACGGGTCTGGGGATGCGGATTTCTGTTACAGGGGGAGTGATCAGAGCATCTTTGTCGAGATGTTTGCCGAGCAG
GAGGCGAGGAGAGAGTATCTTCGGAGGAAACACCGTTCTCTCTTGGACCCCATCATGGAAGTCCTCATCCCTAAC
CGTCCAGGCTCCCCTCCTCCCAAGACGCACATCATGACGGAGCCGATATCGGACATGCTCTCGCCGTCATTCCCC
CACCAACCCTTTGACGCCTCCTCCGTTCAAGACTCCGAGATGGCCATTGTCCTCGATTACTTTTCTCTCCTCGGC
TTCCAGACTTCAAACGCAGAGTTCGACGGCCGCTTCCTCCGTCACGACCTCCCTCTAGGACCCCAAGCCGGAAAG
ACGGGCCTCTTCGACTCCACGACGTGGGGGAGCATCCCGCTCTTCACCGACATGTGCACGGGGGCCATCCCCGTC
ATGCTGCATCATAACTCGGTGGACAAGACGTGGAGGGAGCACGCGTGGCCGAACGCGTGGTGGCATGGGAGGGCG
AGGGCCTTGCTGGAGGGGAGGAGGGGGAGGGGTCGAGGCCTTGGTCGGGGGGTTCGAGGTTGA
Gene >Ophcf2|05163
ATGATGGGTTTTTCGAGGTGCGTGCCGAGGAGGCCTGTTGTCTTGGTGTCTGTGTCGTTGCTGTTTTCGTTTTTG
GTGCTGAGGTTGTTGGTTACGGTGAGTTTTCTCTCGTTGTTGTCCTTGTATGTACGTATGCGCTGACGGGTGTTA
TTCGCAGCATGACTCGTCGTCATGGCATCGTCTAGGCATCAACCGTCAAAGCCAGCAACCCGGCGTGAAACCCTA
CCCGCAAACCAACCAGTCGACCCTACACATTCTCCTCCCAGCAACCCACTCAGACGTGAACCTCTGCAAAACGCT
CCTCACCTTGACCATGGCCGGATACCCGTCTCCCCATATCGTGGCCTGGGGGGGCAAAGACGACGACGGGGCTTT
GAGGGGGGGTGGTTCTCATAACGCCAAGATTACTTCTGCGCTGGCTTTCGTTAATGATGCCGAGAGGAGGAGGGA
GAGAGGTGGGTTTGATGACGAGTTGGTACTCATGGTGGATGCCTATGACGTCTGGTTTCAGCTTCCGGTCGACGT
TCTCCTCGCACGATATCGTTCCATCCTCGCTGACGATGAGGTCCGCGTGAGACACCGAATGGGAAATTCGTACGA
GCACGGAAAGATAGGACACAAGGTCATCTTCGGCGCCGGAAAACGCTGCTCGCCGAACCAGCTCCACACTCTAGC
CTGCTACGCCGTCCCCGAATCCCCCCTCCCGGCGGACACGCACGGCGTCTCGACCGATTCCGTGCTGGGCCGCAC
CTTTATGAGCAACGGCCGGCAGCGCTTCCTGGTGTCCGGGTATATGCTCGGGAGTGTCGGTGCGGTGAGGACCGT
GCTGGAGAGGGCGAATCGGAAGTTGGACGAGTGTGTCGGGAGGACGGGCGTCGCTTTCGACAACGGGTCTGGGGA
TGCGGATTTCTGTTACAGGGGGAGTGATCAGAGCATCTTTGTCGAGATGTTTGCCGAGCAGGAGGCGAGGAGAGA
GTATCTTCGGAGGAAACACCGTTCTCTCTTGGACCCCATCATGGAAGTCCTCATCCCTAACCGTCCAGGCTCCCC
TCCTCCCAAGACGCACATCATGACGGAGCCGATATCGGACATGCTCTCGCCGTCATTCCCCCACCAACCCTTTGA
CGCCTCCTCCGTTCAAGACTCCGAGATGGCCATTGTCCTCGATTACTTTTCTCTCCTCGGCTTCCAGACTTCAAA
CGCAGAGTTCGACGGCCGCTTCCTCCGTCACGACCTCCCTCTAGGACCCCAAGCCGGAAAGACGGGCCTCTTCGA
CTGTCCCCCGCCACCCCCCCCCGGAAGACCTCCTACTAACTCCCCCTCCTCACCCTGCTCTCCAACGGGACCTCC
CCAGCCACGACGTGGGGGAGCATCCCGCTCTTCACCGACATGTGCACGGGGGCCATCCCCGTCATGCTGCATCAT
AACTCGGTGGACAAGACGTGGAGGGAGCACGCGTGGCCGAACGCGTGGTGGCATGGGAGGGCGAGGGCCTTGCTG
GAGGGGAGGAGGGGGAGGGGTCGAGGCCTTGGTCGGGGGGTTCGAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail