Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05160
Gene name
Locationscaffold_05:2654487..2655837
Strand+
Gene length (bp)1350
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02487 CLN3 CLN3 protein 1.4E-147 39 430

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 70 92 22
3 99 116 17
4 126 148 22
5 155 177 22
6 187 206 19
7 271 289 18
8 309 326 17
9 339 361 22
10 365 387 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05160
MASPGRLPAFSPALLGFSPSSRLARLSALLRQPEARVLVAFWLLGLINNVLYVIVLSAAQDLVGSLPKGIVLLAD
VMPSFVVKLVGPYVMHAVPYRVRIPVFIGLASTGMLLVALTPPDRSVSVKMAGVVIASLSSGGGELSFLGLLHYY
GGNGLVGWASGTGAAGLVGAGLYELLTAWLGFEVSQALLLSACLPVVMFISFFFILPQEPLRPSHGVDIRHGYDA
VPSGEAVETPAVMTEALLDSHPSAVEAVYPPKSRSLGANLKRARSLLVPYMIPLFLVYVAEYTINQGVSPTLLFP
PEESPFSQLRGFYPFYGFLYQLGVFISRSSTSFIRVHNLYLPSFFQIGNLMLLTLHSLFYFLPSVYLVFLVIFWE
GLLGGCVYVNCFAEILEKVPAEDREFSLSATATSDSAGISVAGILSIAVETGLCDYQVSHGRKWCRMIQAPDSR*
Coding >Ophcf2|05160
ATGGCCTCTCCAGGCCGTCTGCCCGCCTTCTCCCCTGCTCTCCTCGGCTTCTCTCCCTCTTCCCGACTCGCCCGT
CTCAGCGCCCTCCTCCGTCAACCAGAAGCCCGCGTCCTCGTCGCTTTCTGGCTCCTCGGCCTCATCAACAACGTC
CTATACGTCATTGTCCTCTCCGCCGCGCAGGACCTCGTCGGTTCGCTACCCAAGGGCATCGTCCTCCTCGCAGAC
GTCATGCCCTCCTTCGTCGTCAAGCTGGTGGGCCCTTACGTGATGCACGCCGTGCCATACCGGGTCCGGATCCCC
GTCTTTATAGGCTTGGCTTCGACGGGGATGCTGCTTGTTGCGCTTACGCCGCCTGACCGGTCCGTTTCCGTTAAG
ATGGCGGGCGTCGTTATCGCTAGCTTGAGTAGTGGCGGGGGGGAGCTCAGCTTTCTCGGCCTCCTCCACTACTAC
GGCGGGAACGGTCTGGTCGGGTGGGCTTCCGGGACTGGTGCCGCCGGTCTTGTTGGCGCGGGCCTGTACGAGCTG
TTGACAGCCTGGCTGGGCTTCGAAGTCAGTCAGGCTTTGCTCTTGTCGGCTTGCTTGCCTGTCGTCATGTTTATC
AGCTTCTTCTTCATCCTACCGCAGGAGCCGCTCCGTCCATCTCACGGGGTTGATATCCGTCACGGATATGACGCC
GTGCCGTCTGGAGAGGCGGTCGAGACGCCTGCCGTCATGACGGAGGCGTTGCTGGATTCCCATCCTTCGGCCGTC
GAAGCCGTCTACCCACCCAAGTCACGATCGCTTGGGGCCAATCTCAAGCGTGCCCGGTCTCTGTTGGTGCCGTAC
ATGATTCCTCTATTTCTCGTCTACGTGGCCGAATACACCATCAACCAGGGCGTGTCACCCACTCTGCTATTCCCT
CCCGAAGAGTCGCCCTTTAGCCAGCTTCGCGGCTTCTATCCGTTTTACGGCTTCCTCTATCAGCTCGGCGTCTTC
ATCTCCCGCTCATCGACGTCATTCATTCGCGTGCACAATCTCTACCTACCGTCATTTTTTCAGATTGGAAACCTG
ATGCTGCTGACCCTGCACTCGCTCTTTTACTTCTTGCCGTCCGTCTATCTTGTTTTTCTCGTCATCTTCTGGGAA
GGCCTCCTCGGCGGCTGCGTCTACGTCAACTGCTTCGCCGAGATCCTGGAAAAGGTGCCGGCTGAGGACCGAGAA
TTCAGCCTGAGTGCGACGGCCACCAGTGACAGCGCTGGCATATCCGTAGCCGGCATCCTGAGCATCGCTGTGGAA
ACTGGTCTTTGTGACTATCAGGTGAGCCACGGACGCAAGTGGTGTCGCATGATTCAGGCGCCGGACTCTCGATAA
Transcript >Ophcf2|05160
ATGGCCTCTCCAGGCCGTCTGCCCGCCTTCTCCCCTGCTCTCCTCGGCTTCTCTCCCTCTTCCCGACTCGCCCGT
CTCAGCGCCCTCCTCCGTCAACCAGAAGCCCGCGTCCTCGTCGCTTTCTGGCTCCTCGGCCTCATCAACAACGTC
CTATACGTCATTGTCCTCTCCGCCGCGCAGGACCTCGTCGGTTCGCTACCCAAGGGCATCGTCCTCCTCGCAGAC
GTCATGCCCTCCTTCGTCGTCAAGCTGGTGGGCCCTTACGTGATGCACGCCGTGCCATACCGGGTCCGGATCCCC
GTCTTTATAGGCTTGGCTTCGACGGGGATGCTGCTTGTTGCGCTTACGCCGCCTGACCGGTCCGTTTCCGTTAAG
ATGGCGGGCGTCGTTATCGCTAGCTTGAGTAGTGGCGGGGGGGAGCTCAGCTTTCTCGGCCTCCTCCACTACTAC
GGCGGGAACGGTCTGGTCGGGTGGGCTTCCGGGACTGGTGCCGCCGGTCTTGTTGGCGCGGGCCTGTACGAGCTG
TTGACAGCCTGGCTGGGCTTCGAAGTCAGTCAGGCTTTGCTCTTGTCGGCTTGCTTGCCTGTCGTCATGTTTATC
AGCTTCTTCTTCATCCTACCGCAGGAGCCGCTCCGTCCATCTCACGGGGTTGATATCCGTCACGGATATGACGCC
GTGCCGTCTGGAGAGGCGGTCGAGACGCCTGCCGTCATGACGGAGGCGTTGCTGGATTCCCATCCTTCGGCCGTC
GAAGCCGTCTACCCACCCAAGTCACGATCGCTTGGGGCCAATCTCAAGCGTGCCCGGTCTCTGTTGGTGCCGTAC
ATGATTCCTCTATTTCTCGTCTACGTGGCCGAATACACCATCAACCAGGGCGTGTCACCCACTCTGCTATTCCCT
CCCGAAGAGTCGCCCTTTAGCCAGCTTCGCGGCTTCTATCCGTTTTACGGCTTCCTCTATCAGCTCGGCGTCTTC
ATCTCCCGCTCATCGACGTCATTCATTCGCGTGCACAATCTCTACCTACCGTCATTTTTTCAGATTGGAAACCTG
ATGCTGCTGACCCTGCACTCGCTCTTTTACTTCTTGCCGTCCGTCTATCTTGTTTTTCTCGTCATCTTCTGGGAA
GGCCTCCTCGGCGGCTGCGTCTACGTCAACTGCTTCGCCGAGATCCTGGAAAAGGTGCCGGCTGAGGACCGAGAA
TTCAGCCTGAGTGCGACGGCCACCAGTGACAGCGCTGGCATATCCGTAGCCGGCATCCTGAGCATCGCTGTGGAA
ACTGGTCTTTGTGACTATCAGGTGAGCCACGGACGCAAGTGGTGTCGCATGATTCAGGCGCCGGACTCTCGATAA
Gene >Ophcf2|05160
ATGGCCTCTCCAGGCCGTCTGCCCGCCTTCTCCCCTGCTCTCCTCGGCTTCTCTCCCTCTTCCCGACTCGCCCGT
CTCAGCGCCCTCCTCCGTCAACCAGAAGCCCGCGTCCTCGTCGCTTTCTGGCTCCTCGGCCTCATCAACAACGTC
CTATACGTCATTGTCCTCTCCGCCGCGCAGGACCTCGTCGGTTCGCTACCCAAGGGCATCGTCCTCCTCGCAGAC
GTCATGCCCTCCTTCGTCGTCAAGCTGGTGGGCCCTTACGTGATGCACGCCGTGCCATACCGGGTCCGGATCCCC
GTCTTTATAGGCTTGGCTTCGACGGGGATGCTGCTTGTTGCGCTTACGCCGCCTGACCGGTCCGTTTCCGTTAAG
ATGGCGGGCGTCGTTATCGCTAGCTTGAGTAGTGGCGGGGGGGAGCTCAGCTTTCTCGGCCTCCTCCACTACTAC
GGCGGGAACGGTCTGGTCGGGTGGGCTTCCGGGACTGGTGCCGCCGGTCTTGTTGGCGCGGGCCTGTACGAGCTG
TTGACAGCCTGGCTGGGCTTCGAAGTCAGTCAGGCTTTGCTCTTGTCGGCTTGCTTGCCTGTCGTCATGTTTATC
AGCTTCTTCTTCATCCTACCGCAGGAGCCGCTCCGTCCATCTCACGGGGTTGATATCCGTCACGGATATGACGCC
GTGCCGTCTGGAGAGGCGGTCGAGACGCCTGCCGTCATGACGGAGGCGTTGCTGGATTCCCATCCTTCGGCCGTC
GAAGCCGTCTACCCACCCAAGTCACGATCGCTTGGGGCCAATCTCAAGCGTGCCCGGTCTCTGTTGGTGCCGTAC
ATGATTCCTCTATTTCTCGTCTACGTGGCCGAATACACCATCAACCAGGGCGTGTCACCCACTCTGCTATTCCCT
CCCGAAGAGTCGCCCTTTAGCCAGCTTCGCGGCTTCTATCCGTTTTACGGCTTCCTCTATCAGCTCGGCGTCTTC
ATCTCCCGCTCATCGACGTCATTCATTCGCGTGCACAATCTCTACCTACCGTCATTTTTTCAGATTGGAAACCTG
ATGCTGCTGACCCTGCACTCGCTCTTTTACTTCTTGCCGTCCGTCTATCTTGTTTTTCTCGTCATCTTCTGGGAA
GGCCTCCTCGGCGGCTGCGTCTACGTCAACTGCTTCGCCGAGATCCTGGAAAAGGTGCCGGCTGAGGACCGAGAA
TTCAGCCTGAGTGCGACGGCCACCAGTGACAGCGCTGGCATATCCGTAGCCGGCATCCTGAGCATCGCTGTGGAA
ACTGGTCTTTGTGACTATCAGGTGAGCCACGGACGCAAGTGGTGTCGCATGATTCAGGCGCCGGACTCTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail