Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05159
Gene name
Locationscaffold_05:2653206..2654025
Strand-
Gene length (bp)819
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01265 Cyto_heme_lyase Cytochrome c/c1 heme lyase 1.8E-37 5 247

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0004408 holocytochrome-c synthase activity Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016846 carbon-sulfur lyase activity No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0016829 lyase activity No
GO:0043226 organelle No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Mitochondrial transit peptide 0.4233 0.1247 0.1277 0.2368 0.5554 0.0566 0.6238 0.6258 0.6165 0.2097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1208
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5069
Ophiocordyceps australis map64 (Brazil) OphauB2|2095
Ophiocordyceps camponoti-floridani Ophcf2|05159 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5401
Ophiocordyceps kimflemingae Ophio5|3435
Ophiocordyceps subramaniannii Hirsu2|10367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05159
MANGQDSACPINHKSPTWLSHTVSQEPSQNHPSTPKPQSQTWAQKLSSHLWTRRPSPDHDDKHNLATNRVVSSIP
RSSSSSSTACPAEGIAPSNAEMETGVASSGNWVYPSEKMFFDAMRRKGYDARVVDMKSVVPIHNAVNERAWAQIR
SWEEPYLDRSTCHGPMLESFSNRNDRMTPKARINTLLGYTAPFDRHDWVIDRCGTRVEYVIDFYAGRSDGKPGPS
FYLDVRPKLNTWEGVKMRALKWTHLA*
Coding >Ophcf2|05159
ATGGCCAACGGTCAGGACTCAGCCTGTCCGATCAACCACAAGTCACCAACCTGGCTCTCCCATACCGTCTCCCAA
GAGCCCTCCCAGAATCATCCCTCAACACCCAAACCCCAGAGCCAAACCTGGGCCCAGAAGCTATCCTCACACCTA
TGGACCCGACGCCCATCACCAGACCACGACGACAAGCACAACCTCGCCACGAACCGCGTCGTCTCCTCCATCCCG
CGGTCTTCCTCCTCGTCGTCTACGGCATGTCCCGCGGAGGGCATCGCGCCGTCCAATGCGGAGATGGAAACTGGC
GTGGCCTCGTCTGGAAACTGGGTCTACCCTTCGGAGAAGATGTTCTTTGACGCCATGCGCCGCAAGGGCTATGAC
GCGCGCGTTGTCGACATGAAGAGCGTTGTGCCCATTCACAACGCCGTCAACGAGCGAGCATGGGCCCAGATCCGT
AGCTGGGAGGAGCCTTACCTCGACCGTTCGACCTGCCACGGTCCTATGCTCGAGTCCTTCTCCAACAGAAACGAT
CGCATGACGCCCAAGGCGCGCATCAACACCTTGCTGGGCTACACTGCTCCCTTCGACCGCCACGACTGGGTCATC
GATCGCTGCGGCACTCGCGTCGAGTATGTCATCGACTTTTACGCCGGCCGCTCCGATGGCAAGCCTGGCCCCAGC
TTCTACCTCGACGTCAGGCCCAAGCTGAATACGTGGGAGGGCGTCAAGATGCGTGCTCTAAAGTGGACTCACTTG
GCATGA
Transcript >Ophcf2|05159
ATGGCCAACGGTCAGGACTCAGCCTGTCCGATCAACCACAAGTCACCAACCTGGCTCTCCCATACCGTCTCCCAA
GAGCCCTCCCAGAATCATCCCTCAACACCCAAACCCCAGAGCCAAACCTGGGCCCAGAAGCTATCCTCACACCTA
TGGACCCGACGCCCATCACCAGACCACGACGACAAGCACAACCTCGCCACGAACCGCGTCGTCTCCTCCATCCCG
CGGTCTTCCTCCTCGTCGTCTACGGCATGTCCCGCGGAGGGCATCGCGCCGTCCAATGCGGAGATGGAAACTGGC
GTGGCCTCGTCTGGAAACTGGGTCTACCCTTCGGAGAAGATGTTCTTTGACGCCATGCGCCGCAAGGGCTATGAC
GCGCGCGTTGTCGACATGAAGAGCGTTGTGCCCATTCACAACGCCGTCAACGAGCGAGCATGGGCCCAGATCCGT
AGCTGGGAGGAGCCTTACCTCGACCGTTCGACCTGCCACGGTCCTATGCTCGAGTCCTTCTCCAACAGAAACGAT
CGCATGACGCCCAAGGCGCGCATCAACACCTTGCTGGGCTACACTGCTCCCTTCGACCGCCACGACTGGGTCATC
GATCGCTGCGGCACTCGCGTCGAGTATGTCATCGACTTTTACGCCGGCCGCTCCGATGGCAAGCCTGGCCCCAGC
TTCTACCTCGACGTCAGGCCCAAGCTGAATACGTGGGAGGGCGTCAAGATGCGTGCTCTAAAGTGGACTCACTTG
GCATGA
Gene >Ophcf2|05159
ATGGCCAACGGTCAGGACTCAGCCTGTCCGATCAACCACAAGTCACCAACCTGGCTCTCCCATACCGTCTCCCAA
GAGCCCTCCCAGAATCATCCCTCAACACCCAAACCCCAGAGCCAAACCTGGGCCCAGAAGCTATCCTCACACCTA
TGGACCCGACGCCCATCACCAGACCACGACGACAAGCACAACCTCGCCACGAACCGCGTCGTCTCCTCCATCCCG
CGGTCTTCCTCCTCGTCGTCTACGGCATGTCCCGCGGAGGGCATCGCGCCGTCCAATGCGGAGATGGAAACTGGC
GTGGCCTCGTCTGGAAACTGGGTCTACCCTTCGGAGAAGATGTTCTTTGACGCCATGCGCCGCAAGGGCTATGAC
GCGCGCGTTGTCGACATGAAGAGCGTTGTGCCCATTCACAACGCCGTCAACGAGCGAGCATGGGCCCAGATCCGT
AGCTGGGAGGAGCCTTACCTCGACCGTTCGACGTTCGCATCTCTTCTCCTTATCTACCTACAATAGCACAGGTTT
GCTGACGGATTCGTATGTAGCTGCCACGGTCCTATGCTCGAGTCCTTCTCCAACAGAAACGATCGCATGACGCCC
AAGGCGCGCATCAACACCTTGCTGGGCTACACTGCTCCCTTCGACCGCCACGACTGGGTCATCGATCGCTGCGGC
ACTCGCGTCGAGTATGTCATCGACTTTTACGCCGGCCGCTCCGATGGCAAGCCTGGCCCCAGCTTCTACCTCGAC
GTCAGGCCCAAGCTGAATACGTGGGAGGGCGTCAAGATGCGTGCTCTAAAGTGGACTCACTTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail