Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05155
Gene name
Locationscaffold_05:2646128..2647044
Strand+
Gene length (bp)916
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 3.1E-11 225 288

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1169 0.0585 0.9203 0.0606 0.1253 0.0211 0.2654 0.2855 0.1676 0.0062

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999797

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4583
Ophiocordyceps australis 1348a (Ghana) OphauG2|3462
Ophiocordyceps australis 1348a (Ghana) OphauG2|3271
Ophiocordyceps australis 1348a (Ghana) OphauG2|1070
Ophiocordyceps australis map64 (Brazil) OphauB2|1858
Ophiocordyceps australis map64 (Brazil) OphauB2|7807
Ophiocordyceps australis map64 (Brazil) OphauB2|6069
Ophiocordyceps australis map64 (Brazil) OphauB2|6047
Ophiocordyceps camponoti-floridani Ophcf2|00341
Ophiocordyceps camponoti-floridani Ophcf2|00355
Ophiocordyceps camponoti-floridani Ophcf2|03551
Ophiocordyceps camponoti-floridani Ophcf2|05155 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05704
Ophiocordyceps camponoti-floridani Ophcf2|07227
Ophiocordyceps camponoti-floridani Ophcf2|00720
Ophiocordyceps camponoti-rufipedis Ophun1|1354
Ophiocordyceps camponoti-rufipedis Ophun1|1841
Ophiocordyceps camponoti-rufipedis Ophun1|2519
Ophiocordyceps camponoti-rufipedis Ophun1|2683
Ophiocordyceps camponoti-rufipedis Ophun1|3615
Ophiocordyceps camponoti-rufipedis Ophun1|5398
Ophiocordyceps camponoti-rufipedis Ophun1|7222
Ophiocordyceps kimflemingae Ophio5|7575
Ophiocordyceps kimflemingae Ophio5|1310
Ophiocordyceps kimflemingae Ophio5|3287
Ophiocordyceps kimflemingae Ophio5|3438
Ophiocordyceps kimflemingae Ophio5|4474
Ophiocordyceps kimflemingae Ophio5|5248
Ophiocordyceps kimflemingae Ophio5|6057
Ophiocordyceps kimflemingae Ophio5|6793
Ophiocordyceps kimflemingae Ophio5|7576
Ophiocordyceps kimflemingae Ophio5|8134
Ophiocordyceps kimflemingae Ophio5|8139
Ophiocordyceps subramaniannii Hirsu2|2383
Ophiocordyceps subramaniannii Hirsu2|2879
Ophiocordyceps subramaniannii Hirsu2|2880
Ophiocordyceps subramaniannii Hirsu2|5803
Ophiocordyceps subramaniannii Hirsu2|8099
Ophiocordyceps subramaniannii Hirsu2|9120
Ophiocordyceps subramaniannii Hirsu2|6554
Ophiocordyceps subramaniannii Hirsu2|716
Ophiocordyceps subramaniannii Hirsu2|6536
Ophiocordyceps subramaniannii Hirsu2|1174

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05155
MFFLPTTLAAVLLASVTVVAQEPGSIPSWPPPKFVCGTKSLDKATKQSIERTLQKVKEDEVTKGSDSFFSNNNDP
YNRSYHVKTYFHIIALNGQEKKYFEEVNVIQQNLDALNRVYNKIGIYFVFACSIAIVNPKWAKGGYEEEMKRGLP
KGHRYSHLNIYLLSSVREHEPHLQKPGFEKLGYALHPVPNPDAYLMLMDGVTINAHEAVSDSNPFNKEKQRIIPI
IIHEVGHWLGLQHTFEAGCNGVGDGIDDTPAQSNATFGCPPQRSSCKEGELIGPEYNYMDYAGK*
Coding >Ophcf2|05155
ATGTTTTTTCTACCAACTACTCTGGCCGCTGTCTTGCTGGCTTCCGTCACGGTAGTGGCCCAAGAACCCGGCTCT
ATACCCTCATGGCCGCCGCCAAAGTTTGTCTGCGGGACTAAGAGCCTCGATAAAGCCACCAAACAAAGCATAGAG
AGGACGTTGCAGAAGGTGAAAGAAGATGAAGTGACCAAGGGAAGCGATTCTTTCTTTTCGAACAATAACGACCCA
TACAACAGGTCTTACCACGTCAAGACTTACTTCCACATCATTGCCCTCAATGGACAGGAGAAGAAATACTTTGAA
GAGGTGAACGTCATCCAACAGAATCTCGACGCATTGAACCGGGTCTACAATAAAATAGGAATCTATTTCGTGTTT
GCCTGCTCTATCGCCATCGTCAACCCCAAGTGGGCGAAAGGCGGGTATGAGGAGGAAATGAAGCGAGGGCTGCCC
AAGGGCCACCGCTATAGCCATCTGAATATCTACCTCCTCTCCAGTGTTCGTGAACACGAGCCGCACTTACAAAAG
CCAGGCTTCGAAAAACTCGGATACGCTCTTCATCCCGTACCAAACCCCGATGCGTATCTAATGTTAATGGATGGT
GTCACCATAAACGCCCACGAGGCCGTAAGCGACTCGAACCCGTTTAATAAAGAGAAGCAGAGAATTATCCCTATA
ATCATCCATGAAGTCGGTCACTGGCTGGGACTCCAGCATACGTTTGAAGCAGGTTGCAACGGGGTAGGAGACGGT
ATTGACGACACGCCGGCGCAATCAAACGCGACATTTGGCTGTCCCCCTCAGCGCTCATCTTGCAAAGAAGGGGAG
CTGATTGGTCCTGAATACAATTACATGGACTACGCTGGCAAGTGA
Transcript >Ophcf2|05155
ATGTTTTTTCTACCAACTACTCTGGCCGCTGTCTTGCTGGCTTCCGTCACGGTAGTGGCCCAAGAACCCGGCTCT
ATACCCTCATGGCCGCCGCCAAAGTTTGTCTGCGGGACTAAGAGCCTCGATAAAGCCACCAAACAAAGCATAGAG
AGGACGTTGCAGAAGGTGAAAGAAGATGAAGTGACCAAGGGAAGCGATTCTTTCTTTTCGAACAATAACGACCCA
TACAACAGGTCTTACCACGTCAAGACTTACTTCCACATCATTGCCCTCAATGGACAGGAGAAGAAATACTTTGAA
GAGGTGAACGTCATCCAACAGAATCTCGACGCATTGAACCGGGTCTACAATAAAATAGGAATCTATTTCGTGTTT
GCCTGCTCTATCGCCATCGTCAACCCCAAGTGGGCGAAAGGCGGGTATGAGGAGGAAATGAAGCGAGGGCTGCCC
AAGGGCCACCGCTATAGCCATCTGAATATCTACCTCCTCTCCAGTGTTCGTGAACACGAGCCGCACTTACAAAAG
CCAGGCTTCGAAAAACTCGGATACGCTCTTCATCCCGTACCAAACCCCGATGCGTATCTAATGTTAATGGATGGT
GTCACCATAAACGCCCACGAGGCCGTAAGCGACTCGAACCCGTTTAATAAAGAGAAGCAGAGAATTATCCCTATA
ATCATCCATGAAGTCGGTCACTGGCTGGGACTCCAGCATACGTTTGAAGCAGGTTGCAACGGGGTAGGAGACGGT
ATTGACGACACGCCGGCGCAATCAAACGCGACATTTGGCTGTCCCCCTCAGCGCTCATCTTGCAAAGAAGGGGAG
CTGATTGGTCCTGAATACAATTACATGGACTACGCTGGCAAGTGA
Gene >Ophcf2|05155
ATGTTTTTTCTACCAACTACTCTGGCCGCTGTCTTGCTGGCTTCCGTCACGGTAGTGGCCCAAGAACCCGGCTCT
ATACCCTCATGGCCGCCGCCAAAGTTTGTCTGCGGGACTAAGAGCCTCGATAAAGCCACCAAACAAAGCATAGAG
AGGACGTTGCAGAAGGTGAAAGAAGATGAAGTGACCAAGGGAAGCGATTCTTTCTTTTCGAACAATAACGACCCA
TACAACAGGTCTTACCACGTCAAGACTTACTTCCACATCATTGCCCTCAATGGACAGGAGAAGAAATACTTTGAA
GAGGTAAGCAAAGATAACGGCAAGGGGTCCCATCGACTGACCCAGACAGGTGAACGTCATCCAACAGAATCTCGA
CGCATTGAACCGGGTCTACAATAAAATAGGAATCTATTTCGTGTTTGCCTGCTCTATCGCCATCGTCAACCCCAA
GTGGGCGAAAGGCGGGTATGAGGAGGAAATGAAGCGAGGGCTGCCCAAGGGCCACCGCTATAGCCATCTGAATAT
CTACCTCCTCTCCAGTGTTCGTGAACACGAGCCGCACTTACAAAAGCCAGGCTTCGAAAAACTCGGATACGCTCT
TCATCCCGTACCAAACCCCGATGCGTATCTAATGTTAATGGATGGTGTCACCATAAACGCCCACGAGGCCGTAAG
CGACTCGAACCCGTTTAATAAAGAGAAGCAGAGAATTATCCCTATAATCATCCATGAAGTCGGTCACTGGCTGGG
ACTCCAGCATACGTTTGAAGCAGGTTGCAACGGGGTAGGAGACGGTATTGACGACACGCCGGCGCAATCAAACGC
GACATTTGGCTGTCCCCCTCAGCGCTCATCTTGCAAAGAAGGGGAGCTGATTGGTCCTGAATACAATTACATGGA
CTACGCTGGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail