Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05147
Gene name
Locationscaffold_05:2625011..2626653
Strand+
Gene length (bp)1642
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 9.8E-33 56 216
PF01554 MatE MatE 1.7E-23 276 435

GO

GO Term Description Terminal node
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015297 antiporter activity Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 83 105 22
3 131 153 22
4 165 182 17
5 197 219 22
6 224 246 22
7 269 291 22
8 304 326 22
9 346 368 22
10 420 442 22
11 447 469 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 115.64 64.41 166.87
Alive In ants, during behavior modification 256.42 104.28 408.56
Dead In ants, recently dead 183.47 93.58 273.36

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000657 yes
Alive Dead 0.103441 no
Dead Fungus 0.022041 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05147
MPTHDTPPVEDEHRSLLSHVVSTSYGMADSANDQASDPPGSTRSHEARVLLSYSLPLIVTSLLQYSINLSGIFTV
GRLGRAELGAVSLANTTFIISCLAPFQGLATSLDTLCAQAYGSGQKHLVGLQCQRMLSFLFCLTVPLAVFWCASE
HLLRRLVSDAETARLAGLYLKIAIASLPGIILFETGKRFVQAQGLFRATTYVLLIAAPANLLLSWLLVYRLRLGF
VGAPIALAATQNLLGLLLILYVRFVDGSTCWGGLDHRAFSNWCIMIRLALPSMIMVEAEWFAFHAVTLFAGRFGT
DYLAAQSVLMTLMTISFQLPFPLSIGASTRVANLIGGRRTEAAKMAAQVTFITAAVIGVANVTIFILLRSRLPLL
FTKDEQVIAIVARTSPFVAVAQLFDSLGTGANGLLRGVGRQTVGGMAGLFAYYVVSLPVSLALAFGADWKLAGMW
TGLAIGLSIVTVIEYSYLLRADWDKAASEAAKRNKAY*
Coding >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTTCAGGGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGC
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCC
AGCCTCCCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACG
TACGTGCTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTC
GTCGGGGCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACC
GACTATCTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCGTCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTA
TTCACCAAAGACGAACAGGTCATTGCCATCGTCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGAC
AGCCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTCTCGCTGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATCGGGCTGTCGATCGTGACGGTCATCGAGTATAGCTATCTGCTTAGGGCGGATTGGGACAAG
GCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA
Transcript >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTTCAGGGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGC
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCC
AGCCTCCCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACG
TACGTGCTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTC
GTCGGGGCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACC
GACTATCTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCGTCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTA
TTCACCAAAGACGAACAGGTCATTGCCATCGTCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGAC
AGCCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTCTCGCTGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATCGGGCTGTCGATCGTGACGGTCATCGAGTATAGCTATCTGCTTAGGGCGGATTGGGACAAG
GCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA
Gene >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCGTGAGAAGACTTCCTTCCTTCCATCCATCCTTTCATCA
TGTCGTCAGCTCTTGACTAACCGTCATACAGTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCCTTTCAG
GGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGCCTGCAA
TGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAACACCTG
CTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCCAGCCTC
CCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACGTACGTG
CTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTCGTCGGG
GCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTCGATGGC
TCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTGCCGAGC
ATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACCGACTAT
CTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATCGGGGCG
TCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGGTATTATGT
CTTACGGTGAGAGGAAGAAGAAACTTGACTAACGGCTTCAGACGTTTATCACGGCCGCCGTCATCGGCGTGGCAA
ACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTATTCACCAAAGACGAACAGGTCATTGCCATCG
TCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGACAGCCTCGGCACCGGCGCCAACGGGCTCCTCC
GCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTCGCCTACTACGTCGTCTCGCTGCCCGTCTCGC
TGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGGACGGGGCTGGCGATCGGGCTGTCGATGTGAG
TTGTTCTCGTCTGTTTGTTTTCTTTGATGCTTACGGGAGTCAAAATTTGTTTAGCGTGACGGTCATCGAGTATAG
CTATCTGCTTAGGGCGGATTGGGACAAGGCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail