Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05147
Gene name
Locationscaffold_05:2625011..2626653
Strand+
Gene length (bp)1642
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 9.8E-33 56 216
PF01554 MatE MatE 1.7E-23 276 435

GO

GO Term Description Terminal node
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015297 antiporter activity Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 83 105 22
3 131 153 22
4 165 182 17
5 197 219 22
6 224 246 22
7 269 291 22
8 304 326 22
9 346 368 22
10 420 442 22
11 447 469 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05147
MPTHDTPPVEDEHRSLLSHVVSTSYGMADSANDQASDPPGSTRSHEARVLLSYSLPLIVTSLLQYSINLSGIFTV
GRLGRAELGAVSLANTTFIISCLAPFQGLATSLDTLCAQAYGSGQKHLVGLQCQRMLSFLFCLTVPLAVFWCASE
HLLRRLVSDAETARLAGLYLKIAIASLPGIILFETGKRFVQAQGLFRATTYVLLIAAPANLLLSWLLVYRLRLGF
VGAPIALAATQNLLGLLLILYVRFVDGSTCWGGLDHRAFSNWCIMIRLALPSMIMVEAEWFAFHAVTLFAGRFGT
DYLAAQSVLMTLMTISFQLPFPLSIGASTRVANLIGGRRTEAAKMAAQVTFITAAVIGVANVTIFILLRSRLPLL
FTKDEQVIAIVARTSPFVAVAQLFDSLGTGANGLLRGVGRQTVGGMAGLFAYYVVSLPVSLALAFGADWKLAGMW
TGLAIGLSIVTVIEYSYLLRADWDKAASEAAKRNKAY*
Coding >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTTCAGGGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGC
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCC
AGCCTCCCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACG
TACGTGCTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTC
GTCGGGGCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACC
GACTATCTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCGTCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTA
TTCACCAAAGACGAACAGGTCATTGCCATCGTCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGAC
AGCCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTCTCGCTGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATCGGGCTGTCGATCGTGACGGTCATCGAGTATAGCTATCTGCTTAGGGCGGATTGGGACAAG
GCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA
Transcript >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTTCAGGGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGC
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCC
AGCCTCCCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACG
TACGTGCTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTC
GTCGGGGCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACC
GACTATCTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCGTCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTA
TTCACCAAAGACGAACAGGTCATTGCCATCGTCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGAC
AGCCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTCTCGCTGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATCGGGCTGTCGATCGTGACGGTCATCGAGTATAGCTATCTGCTTAGGGCGGATTGGGACAAG
GCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA
Gene >Ophcf2|05147
ATGCCGACACACGATACCCCCCCTGTCGAAGACGAGCATCGCAGCCTCCTATCCCATGTCGTCTCGACCTCGTAC
GGCATGGCAGACTCGGCCAATGACCAGGCCTCGGACCCCCCGGGCTCTACGCGGAGCCACGAAGCCAGAGTCCTC
CTGTCATATTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTATTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGGAGAGCCGAGTTGGGCGCCGTCTCGCGTGAGAAGACTTCCTTCCTTCCATCCATCCTTTCATCA
TGTCGTCAGCTCTTGACTAACCGTCATACAGTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCCTTTCAG
GGCCTCGCCACCAGTCTCGACACTCTCTGTGCCCAGGCCTACGGCTCGGGTCAGAAACACCTCGTCGGCCTGCAA
TGCCAGCGCATGCTCTCCTTTCTCTTCTGTCTGACGGTGCCCCTGGCCGTCTTTTGGTGCGCGTCGGAACACCTG
CTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGCTGGCGGGCTTATACCTCAAGATCGCCATCGCCAGCCTC
CCCGGCATCATCCTCTTCGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCGACGACGTACGTG
CTGCTCATCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTGGTATACAGGCTGCGGCTGGGCTTCGTCGGG
GCCCCCATTGCCCTGGCGGCCACGCAGAATCTGCTGGGCCTACTGCTGATCCTCTACGTCCGCTTCGTCGATGGC
TCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCGAATTGGTGCATCATGATCCGTCTAGCGCTGCCGAGC
ATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCCGTCACCCTCTTTGCCGGACGATTCGGCACCGACTAT
CTCGCTGCTCAGAGCGTGCTGATGACGCTCATGACTATATCCTTTCAGCTGCCCTTTCCCCTATCCATCGGGGCG
TCGACACGAGTGGCCAACCTCATTGGCGGCAGACGGACCGAGGCGGCCAAGATGGCGGCCCAAGTGGTATTATGT
CTTACGGTGAGAGGAAGAAGAAACTTGACTAACGGCTTCAGACGTTTATCACGGCCGCCGTCATCGGCGTGGCAA
ACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCGCTGCTATTCACCAAAGACGAACAGGTCATTGCCATCG
TCGCCCGCACCTCGCCCTTCGTCGCCGTGGCCCAGCTCTTCGACAGCCTCGGCACCGGCGCCAACGGGCTCCTCC
GCGGCGTCGGCAGACAGACGGTCGGCGGCATGGCCGGTCTTTTCGCCTACTACGTCGTCTCGCTGCCCGTCTCGC
TGGCGCTGGCCTTTGGAGCGGACTGGAAGCTGGCCGGCATGTGGACGGGGCTGGCGATCGGGCTGTCGATGTGAG
TTGTTCTCGTCTGTTTGTTTTCTTTGATGCTTACGGGAGTCAAAATTTGTTTAGCGTGACGGTCATCGAGTATAG
CTATCTGCTTAGGGCGGATTGGGACAAGGCTGCTTCCGAGGCGGCGAAGCGAAATAAGGCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail